Sequence:
download
HI:HIT000092897sequence.fasta
>DPY19L2P2 MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIFILNGLMMGLFFIYGTYLSGT ELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQMYVLTLILRTSSNDRRPFIALCLSNVAFMLPWQFAQFILFT QIASLFPMYVVGYIEPSKFQKIIYMNMISVTLSFILMFGNSMYLSSYYSSSLLMTWAIILKRNEIQKLGVSKLNCWLIQG SAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDFDTLKYTCSPEFDFMEKATLLIYTKTLLLPVVMVITCFIFK KTVGDISRVLATNVYLRCCLCRCHAYNGKCQAVYTSSHCESSTLRRCRLEAWLQHA
view sequence (376 aa)
>DPY19L2P2
MADSRRVIIASWYRTFMGIVNLFGLETKTCWNVTRIEPLNEVQSCEGLRDPACFYVGVIFILNGLMMGLFFIYGTYLSGT
ELGGLITVLCFFFNHGEATCVMWTPPLRESFSYPFLVLQMYVLTLILRTSSNDRRPFIALCLSNVAFMLPWQFAQFILFT
QIASLFPMYVVGYIEPSKFQKIIYMNMISVTLSFILMFGNSMYLSSYYSSSLLMTWAIILKRNEIQKLGVSKLNCWLIQG
SAWWCGTIILKFLTSKILGVSDHICLSDLIAAGILRYTDFDTLKYTCSPEFDFMEKATLLIYTKTLLLPVVMVITCFIFK
KTVGDISRVLATNVYLRCCLCRCHAYNGKCQAVYTSSHCESSTLRRCRLEAWLQHA
Estimated Isoelectric Point:
8.73755645751953
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr27
Lys14
Gln10
Leu49
Gly20
Met15
Ser30
Tyr18
His5
Glu13
Arg17
Cys18
Phe26
Pro11
Val23
Asn13
Ala18
Ile31
Trp9
Asp9