Sequence:
download
FLYBASE:CG9852sequence.fasta
>140up-PB MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLERLKQMFTIDEFGSISSELNSVYQAGFLGFLI GAIYGGVTQSRVAYMNFMENNQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMSVYRGKSSIYE YLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSLLLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDEN PELFKAHDEKTSEHVSLDTIK
view sequence (261 aa)
>140up-PB
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLERLKQMFTIDEFGSISSELNSVYQAGFLGFLI
GAIYGGVTQSRVAYMNFMENNQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMSVYRGKSSIYE
YLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSLLLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDEN
PELFKAHDEKTSEHVSLDTIK
Estimated Isoelectric Point:
8.73937225341797
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys21
Gln9
Leu23
Gly28
Met8
Ser19
Tyr11
His3
Glu18
Arg10
Cys1
Phe19
Pro4
Val12
Asn9
Ala20
Ile15
Trp5
Asp10