Sequence:
download
FLYBASE:CG9486sequence.fasta
>AANATL2-PB MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVDGERIVGVVLAGELV PEDLEREYQEAEQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEATIELGRQRGFP VVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVLRASEPHTSASVVAIRL
view sequence (216 aa)
>AANATL2-PB
MSAITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVDGERIVGVVLAGELV
PEDLEREYQEAEQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYMLGVDVSIRRQRVGTRLVEATIELGRQRGFP
VVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHGEIVLRASEPHTSASVVAIRL
Estimated Isoelectric Point:
5.14676666259766
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys9
Gln10
Leu23
Gly11
Met6
Ser13
Tyr7
His6
Glu24
Arg15
Cys3
Phe6
Pro7
Val19
Asn4
Ala18
Ile15
Asp10