Sequence:
download
FLYBASE:CG7583sequence.fasta
>CtBP-PH MDKNLMMPKRSRIDVKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPE QVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLN EHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNGALKDAPNLICTPHAAFFSDAS ATELREMAATEIRRAIVGNIPDVLRNCVNKEYFMRTPPAAAAGGVAAAVYPEGLNGGYYTGALHHRAHSTTPHDGPHSTT NLGSTVGGGPTTVAQAAAAAVAAAAAAALLPSPVPSHLSPQVGGLPLGIVSSQSPLSAPDPNNHLSSSIKTEVKAESTEA P
view sequence (481 aa)
>CtBP-PH
MDKNLMMPKRSRIDVKGNFANGPLQARPLVALLDGRDCSIEMPILKDVATVAFCDAQSTSEIHEKVLNEAVGALMWHTII
LTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMVREGKKFTGPE
QVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLN
EHNHHLINEFTIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNGALKDAPNLICTPHAAFFSDAS
ATELREMAATEIRRAIVGNIPDVLRNCVNKEYFMRTPPAAAAGGVAAAVYPEGLNGGYYTGALHHRAHSTTPHDGPHSTT
NLGSTVGGGPTTVAQAAAAAVAAAAAAALLPSPVPSHLSPQVGGLPLGIVSSQSPLSAPDPNNHLSSSIKTEVKAESTEA
P
Estimated Isoelectric Point:
6.35074615478516
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys19
Gln10
Leu49
Gly41
Met10
Ser25
Tyr11
His16
Glu25
Arg25
Cys9
Phe13
Pro28
Val34
Asn23
Ala62
Ile25
Trp2
Asp24