Sequence:
download
FLYBASE:CG7518sequence.fasta
>CG7518-PH MADQVAHTKETDADEPLVNGELPMEEAPPSCCHVMSLSSMDVDVDADAEGDVDATASSSCVATASQLNPSPPPAGVQQAK PARSSSPPCQLLERLSFPDGNIINTLHTILALPPFDPYAPAPKAETVYKEVVSLMQWSQREDNAIELELSDKLLHECEHK GGDPNDETRSYLMAIENMRLFSEDPKNPLRDADGQLRAITLYFQNLAFIFVKHRKEEFFTFCSCKECLEYRETIMAIMMD QFKAAHMVVMLLDVLIKAYSPMLKNDAAYNKFEKLLECNKEIYWITSGYLYDKNAEYLDFIDDTAISDNMILVLFSAILM ANNPMLLLQILAYNVECIVKAFSEGMIEIAQNIQENEKISAERMLTYILDGYSDLNCISQKISLSLFAFENDFLRKFRLS WVLLCQRLFQQHVFTPLGDTMLACILSLKEVAPSAQTTALIKRYMLFDEHMHSIERRWTDIWIELNKFNLSPTEHERRMG LLDVYNIFDKVVLDATSFSLPDISDDEFIDFQRIVDRQLAWKNIMAFTKLKWPDGFYDPPNKLVHEDLCKKCNSLLEHHN ENCKCITCSIAGTPLRPRQAGHCAKCTTLGIVEKDPKLMKSKILSTCTSDEAKHNAAIAATTSSSTSTAQQQRRTSDLPE DESPTGSGSSGSVFRRQAETSDTLRTTYHIAWAVFQHLATRKRYRHETIEPQFICGENCRVSACQLARKILSNQLSPLLT KYLLRCFQPLSFTREELRSTIPSLMFFNRKLAPSPAELQELRNQHYVYKTYWTFVLSIYANFFVKFNSSSTDFGHLELIK GDLRLRLNSVVGDKEDNRFEQFLAQVIGYSPFKVTDDFTLGDANIEKLQFGVDQLMMLHDSQIIKRTKPDSTTGLSGAKS KLGESNVPQSGGKNGEAGGNKKSKEKMRKCCSDYADIGEPCKENHSKKRVKKECNHARFNETRDRLRKKLSQIVNERKTK STEETTPSKTKCSKPEPVAVPAPAAIPPKRPPSPFNPPKLPAVLAVAALDRICREEHEDDSLLRLDSLCKSLQRHTDATD ASAAAAALAAFKHGSGFPADYSKEDMMQDFAEFLGTYTYTREQDQQRWINETLNFIEGKSQQPHTANPKKAAKKAKQKMR KEEEKRIKELEDLRCQFLDIYFKEFIDKYEMKTLTAAGGRKKEKKRIGELETNIKNLQRAKAKVETVILELIATVKQTNS EFKFSYLPTKQQQLAKMAQLEEILNGGPTTATAEPVRQEPPQQSAPQYPEFSSNASFYHPPGLGQQNTPVCFAPPQQSQH PPQLSRDVIAAMAASSITADPSKRIVTIRRVQLPHPGAEQQVTVVAKGSAPHEDKLLYTFVNGHMVASGPIQPEEMAPRQ ATVPAPAPSVPEKSAKAKKKEAKRAAAAAAAEAAAAAEAAAAAAAEAAAEQKAKLKNKKQAKKTAVAVATASSSTASSNS SKSQTPQSTRESSVCSVKPKTVPKKPTSKPPKVVEVTPPPPVPEPEPEPPKRQKRLKSRLDPGQLDNNPWKALHMQDSSE GEWETGSESDEGVPTPAQPPIRQQPKLPAAPAPKPVAPSVVTKAKPAPAAVAAPAKKVKQQEAPAHQKQPAAKTQAQPKS KSTFASVGKSNPPQQQQQQYQQEKVPPTKSQQQRPAESSRKQKQAPGNLESNRSAPNQRCEHLQTQQAPRSGRVNGRTKP TPGGQQQPVQQHSNAHAAESIAPPKKSQRGKRGHRQKQEDLSGIPHNMGYFNPNEIAIPPQSGSYASTLAQQLQHLRISQ PGGSSNSKEASQSPNCSIMDQLNRGVQVEHLSLPPGITLTKVDPAKSEQLRQKSESIRLLSKPLAEQQQQQHHFQQQSHL LAGYYGAAGAAGMDPNGVIMVEANPRPNRSQAPVAPPNVAAAASAASANGKASRRRRRNRGKSGGGSGGNPGSSGAANKQ RTGGEGGGSAAGAADGQILANSPATAATIEANASGNIITLRNPMFHQGNGPVAGGGMMPPNPNPMPPVRSFGAGLPVPPA MSLDQPAAIIKNENGMFTIRNPALHQAVTNGLAMGGYRQFGGNVNYYTPQEAVAEAARAAQQKLQQQQQAGSAAPVAHGG GDSSNFSYFSSGSASGNGSGSSNGGNGTHNNISISCTNVPPTSAESPGRLVGEAAVIARPKHSQKCLSAIGSELKQKASK WPCFGQQQQQQQQQQDYSNSAGGSTSGVPLQEQYQQSSYYNGFEVFSAAAATASHGPGNGGVSTDCHMHHNCGDDSPPPT ITGFNSYLEGIPNTGVIRYDDAAFLKNLIPGQHLNNEVSIHNISESNFTRNNASPSPHHVEITSVFGNRARSSNAYDPQQ QPPPVPGANYCDNVAADYGSDSHLFVQNNLLTRMAQPAVPPDPFGYDFDPSSVVPGGGSKAASVASDLNEFLRRSPLSQR TSPYSQDENAAALETFVQNMNALQIATDAECSRLNGTGTGGGPSDVASADATAGGAANAAAAWW
view sequence (2464 aa)
>CG7518-PH
MADQVAHTKETDADEPLVNGELPMEEAPPSCCHVMSLSSMDVDVDADAEGDVDATASSSCVATASQLNPSPPPAGVQQAK
PARSSSPPCQLLERLSFPDGNIINTLHTILALPPFDPYAPAPKAETVYKEVVSLMQWSQREDNAIELELSDKLLHECEHK
GGDPNDETRSYLMAIENMRLFSEDPKNPLRDADGQLRAITLYFQNLAFIFVKHRKEEFFTFCSCKECLEYRETIMAIMMD
QFKAAHMVVMLLDVLIKAYSPMLKNDAAYNKFEKLLECNKEIYWITSGYLYDKNAEYLDFIDDTAISDNMILVLFSAILM
ANNPMLLLQILAYNVECIVKAFSEGMIEIAQNIQENEKISAERMLTYILDGYSDLNCISQKISLSLFAFENDFLRKFRLS
WVLLCQRLFQQHVFTPLGDTMLACILSLKEVAPSAQTTALIKRYMLFDEHMHSIERRWTDIWIELNKFNLSPTEHERRMG
LLDVYNIFDKVVLDATSFSLPDISDDEFIDFQRIVDRQLAWKNIMAFTKLKWPDGFYDPPNKLVHEDLCKKCNSLLEHHN
ENCKCITCSIAGTPLRPRQAGHCAKCTTLGIVEKDPKLMKSKILSTCTSDEAKHNAAIAATTSSSTSTAQQQRRTSDLPE
DESPTGSGSSGSVFRRQAETSDTLRTTYHIAWAVFQHLATRKRYRHETIEPQFICGENCRVSACQLARKILSNQLSPLLT
KYLLRCFQPLSFTREELRSTIPSLMFFNRKLAPSPAELQELRNQHYVYKTYWTFVLSIYANFFVKFNSSSTDFGHLELIK
GDLRLRLNSVVGDKEDNRFEQFLAQVIGYSPFKVTDDFTLGDANIEKLQFGVDQLMMLHDSQIIKRTKPDSTTGLSGAKS
KLGESNVPQSGGKNGEAGGNKKSKEKMRKCCSDYADIGEPCKENHSKKRVKKECNHARFNETRDRLRKKLSQIVNERKTK
STEETTPSKTKCSKPEPVAVPAPAAIPPKRPPSPFNPPKLPAVLAVAALDRICREEHEDDSLLRLDSLCKSLQRHTDATD
ASAAAAALAAFKHGSGFPADYSKEDMMQDFAEFLGTYTYTREQDQQRWINETLNFIEGKSQQPHTANPKKAAKKAKQKMR
KEEEKRIKELEDLRCQFLDIYFKEFIDKYEMKTLTAAGGRKKEKKRIGELETNIKNLQRAKAKVETVILELIATVKQTNS
EFKFSYLPTKQQQLAKMAQLEEILNGGPTTATAEPVRQEPPQQSAPQYPEFSSNASFYHPPGLGQQNTPVCFAPPQQSQH
PPQLSRDVIAAMAASSITADPSKRIVTIRRVQLPHPGAEQQVTVVAKGSAPHEDKLLYTFVNGHMVASGPIQPEEMAPRQ
ATVPAPAPSVPEKSAKAKKKEAKRAAAAAAAEAAAAAEAAAAAAAEAAAEQKAKLKNKKQAKKTAVAVATASSSTASSNS
SKSQTPQSTRESSVCSVKPKTVPKKPTSKPPKVVEVTPPPPVPEPEPEPPKRQKRLKSRLDPGQLDNNPWKALHMQDSSE
GEWETGSESDEGVPTPAQPPIRQQPKLPAAPAPKPVAPSVVTKAKPAPAAVAAPAKKVKQQEAPAHQKQPAAKTQAQPKS
KSTFASVGKSNPPQQQQQQYQQEKVPPTKSQQQRPAESSRKQKQAPGNLESNRSAPNQRCEHLQTQQAPRSGRVNGRTKP
TPGGQQQPVQQHSNAHAAESIAPPKKSQRGKRGHRQKQEDLSGIPHNMGYFNPNEIAIPPQSGSYASTLAQQLQHLRISQ
PGGSSNSKEASQSPNCSIMDQLNRGVQVEHLSLPPGITLTKVDPAKSEQLRQKSESIRLLSKPLAEQQQQQHHFQQQSHL
LAGYYGAAGAAGMDPNGVIMVEANPRPNRSQAPVAPPNVAAAASAASANGKASRRRRRNRGKSGGGSGGNPGSSGAANKQ
RTGGEGGGSAAGAADGQILANSPATAATIEANASGNIITLRNPMFHQGNGPVAGGGMMPPNPNPMPPVRSFGAGLPVPPA
MSLDQPAAIIKNENGMFTIRNPALHQAVTNGLAMGGYRQFGGNVNYYTPQEAVAEAARAAQQKLQQQQQAGSAAPVAHGG
GDSSNFSYFSSGSASGNGSGSSNGGNGTHNNISISCTNVPPTSAESPGRLVGEAAVIARPKHSQKCLSAIGSELKQKASK
WPCFGQQQQQQQQQQDYSNSAGGSTSGVPLQEQYQQSSYYNGFEVFSAAAATASHGPGNGGVSTDCHMHHNCGDDSPPPT
ITGFNSYLEGIPNTGVIRYDDAAFLKNLIPGQHLNNEVSIHNISESNFTRNNASPSPHHVEITSVFGNRARSSNAYDPQQ
QPPPVPGANYCDNVAADYGSDSHLFVQNNLLTRMAQPAVPPDPFGYDFDPSSVVPGGGSKAASVASDLNEFLRRSPLSQR
TSPYSQDENAAALETFVQNMNALQIATDAECSRLNGTGTGGGPSDVASADATAGGAANAAAAWW
Estimated Isoelectric Point:
8.60553741455078
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr125
Lys164
Gln169
Leu174
Gly146
Met51
Ser216
Tyr55
His59
Glu148
Arg112
Cys44
Phe82
Pro192
Val112
Asn126
Ala269
Ile99
Trp15
Asp106