Sequence:
download
FLYBASE:CG7363sequence.fasta
>w-cup-PA MEETEILKNQNVPQTDKMKAASAHSEHNELHFMNHSYSEDSKESLGQMSLEQNKFSAVKNLTKQQSHLHNSEESRAQENT NEITRKPAETEKKRDISSNEKETKYFVLNNSNESKEQYQAEAKIERNKCKELIIDKISDETISPKTKAQSQMKLNDAVSD KTLTIENARKSKQLIAEETLNSPKEESSNVVENLPSSPEKPVKEEVQEAKEQDTIIPQSEEVKIEKLDQMEASTSSAAQE AEMKKPNEVMPGKEEYIDPREKIRKDMEEYFSGIQALEVKKTIRDELSAKEGEVILREDQRKKTWKGMLLSVTHTTLSTS TSHSTSSGKPPKSAVQAIPQRTAKADFKRKMYVLKENYNYRLELLKQLKNDMKNNYKSEAQQLYIHYHSIKNQTLNSPPL KEMLDAKEE
view sequence (409 aa)
>w-cup-PA
MEETEILKNQNVPQTDKMKAASAHSEHNELHFMNHSYSEDSKESLGQMSLEQNKFSAVKNLTKQQSHLHNSEESRAQENT
NEITRKPAETEKKRDISSNEKETKYFVLNNSNESKEQYQAEAKIERNKCKELIIDKISDETISPKTKAQSQMKLNDAVSD
KTLTIENARKSKQLIAEETLNSPKEESSNVVENLPSSPEKPVKEEVQEAKEQDTIIPQSEEVKIEKLDQMEASTSSAAQE
AEMKKPNEVMPGKEEYIDPREKIRKDMEEYFSGIQALEVKKTIRDELSAKEGEVILREDQRKKTWKGMLLSVTHTTLSTS
TSHSTSSGKPPKSAVQAIPQRTAKADFKRKMYVLKENYNYRLELLKQLKNDMKNNYKSEAQQLYIHYHSIKNQTLNSPPL
KEMLDAKEE
Estimated Isoelectric Point:
6.05242156982422
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys53
Gln25
Leu29
Gly6
Met13
Ser42
Tyr11
His10
Glu56
Arg13
Cys1
Phe5
Pro16
Val15
Asn27
Ala25
Ile21
Trp1
Asp16