Sequence:
download
FLYBASE:CG5336sequence.fasta
>Ced-12-PA MIPKKTTVKDSHIVKIAVEREDHIAQLINLDQRHPLASKIQEICNGWSISDHQNYALQFYEPTNRKYVTEKNRNEIKNGS VLQLQYSPSKTACDAMEVLLNGSPQEKALRLKELTSLSTDHTFALEFIKEKGLDTLIKMIEDGGQTNEDILKYSLASFVE LMEHGTVSWEVPENSFVARNIEIVRNFQKYPTNCGESALSNLENIVMCSNKHVLVAEDIKLQDILRLLQDVNSPVMRQNA IALLNALFVKADEGRRRTIAQTISAKQFRLALIGNGLGTEMTHQLYVLQTLTLGLLEKRMRMKMNAQDQDAHEKIKELRR IAFDDNTNALNQNDDHIRRGGGSGAGNVNFSQYYKKLGFKCDINPAQDFIETPPGILALDCMVYFARNYTQQYAKIVREN SCRADEHECPFGRTSIELVKVLCDILRIGEPPAEQSGDFQPMFFTHDSPFEEFFCICVITLNRTWKDMRATAEDFSTTFS VVREQIQRTLKGRPENLDDFRNKIALLTYQQITTLRQQERTSKEECDSTASAIVKLKEKISPQILELIKQQRLSFLVEGT HFAKYLRGTRTKDKFWYARLSPNHKVIHYGDCDEKTIPTMEELPKKLPISEIKQLLEGKECPHMKETRIRKSAVNLAFSI TFENMEHSTLDFVAPDESIFNYWTDGINALLGQPMVSKQKNEDFDTLLSMEIKLRLLDTEGVDISKDPPPIPEDPENYDF CFES
view sequence (724 aa)
>Ced-12-PA
MIPKKTTVKDSHIVKIAVEREDHIAQLINLDQRHPLASKIQEICNGWSISDHQNYALQFYEPTNRKYVTEKNRNEIKNGS
VLQLQYSPSKTACDAMEVLLNGSPQEKALRLKELTSLSTDHTFALEFIKEKGLDTLIKMIEDGGQTNEDILKYSLASFVE
LMEHGTVSWEVPENSFVARNIEIVRNFQKYPTNCGESALSNLENIVMCSNKHVLVAEDIKLQDILRLLQDVNSPVMRQNA
IALLNALFVKADEGRRRTIAQTISAKQFRLALIGNGLGTEMTHQLYVLQTLTLGLLEKRMRMKMNAQDQDAHEKIKELRR
IAFDDNTNALNQNDDHIRRGGGSGAGNVNFSQYYKKLGFKCDINPAQDFIETPPGILALDCMVYFARNYTQQYAKIVREN
SCRADEHECPFGRTSIELVKVLCDILRIGEPPAEQSGDFQPMFFTHDSPFEEFFCICVITLNRTWKDMRATAEDFSTTFS
VVREQIQRTLKGRPENLDDFRNKIALLTYQQITTLRQQERTSKEECDSTASAIVKLKEKISPQILELIKQQRLSFLVEGT
HFAKYLRGTRTKDKFWYARLSPNHKVIHYGDCDEKTIPTMEELPKKLPISEIKQLLEGKECPHMKETRIRKSAVNLAFSI
TFENMEHSTLDFVAPDESIFNYWTDGINALLGQPMVSKQKNEDFDTLLSMEIKLRLLDTEGVDISKDPPPIPEDPENYDF
CFES
Estimated Isoelectric Point:
5.83003997802734
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr45
Lys52
Gln38
Leu71
Gly31
Met18
Ser42
Tyr18
His17
Glu60
Arg39
Cys15
Phe33
Pro30
Val33
Asn40
Ala41
Ile52
Trp5
Asp44