Sequence:
download
FLYBASE:CG4405sequence.fasta
>jp-PF MQQAGQLTPQQQQQQQQQLLQQQQQQNGGDLAAYAASQAAGGRRGPINGGRFDFEDGGTYCGGWDEGKAHGHGVCTGPKH QGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEG YQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGLASHHRRKNLHASLSSLRSGENGNAAKMVEKAEEIRGGFVLTA KSDKLPVRRNSLTDKTGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTKSNHTESNASFT MEDEQLDPTVVETYMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILITSQKKKHLFL ARSRKLRDRIAAALSSAQRALKMAMQRSDMAISRMATAAAKAQNADAAAEQARMDCENAVRMAREFAPDFKPSVLERFEK LRFRERERFRPGPAAASDASVKMGVGLQTQQQQQQQGQFSPTSSSGSDAYATQAQRQQQYLNMQQQQQQQRRMSQQKHES ECPVPPSMYSQQLPVSPQTDLSGMVSQAQPSHAQVISAINQMYHQQQHQQQQQLNQQQSNPQMNPAYQFQQQQPPGQAKI NPNLNANLKQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQGLQQQPSLHASP THNASNLLRRASQMQQQQIQETAAAAAMAANAAAMAAAQQQQRSGRPPMLGQMGQQSSIDHFDHYKRPPSRDSSIDRYAR AASRLSGAFAGSRQASLDRSGIADPVTNGGTSTPDGRPRAGSVFRGSTPQPGAGTSTMTGNGSLPSGNGGGRLSRAGTPS LGAGGRAPSQGKTEPLFSSPNQPFEDVLLRQRTLGQDIIPSPSQPKRTESLYLPAKPATPVGMAMGGKGGGGGGGKKMKS VPINVTLQRKKSMPDFQELPRATEAMSREEVSALGSARREAVRRQIEVNERLKANPLLYLVSPQVKDWFVRQQLMLLVLI FNVALALLFVYMLT
view sequence (1054 aa)
>jp-PF
MQQAGQLTPQQQQQQQQQLLQQQQQQNGGDLAAYAASQAAGGRRGPINGGRFDFEDGGTYCGGWDEGKAHGHGVCTGPKH
QGAYAGAWNYGFEVSGSYIWPSGSHYEGQWQNGRRHGLGVEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEG
YQDGSGCETYADGGKYQGQWQEGKRHGYGIRTSAPFGLASHHRRKNLHASLSSLRSGENGNAAKMVEKAEEIRGGFVLTA
KSDKLPVRRNSLTDKTGKKGFLMNLKMRKQRSTGDLEKRGTIASGSIRSTMSSASWISTGSEQSNLTTKSNHTESNASFT
MEDEQLDPTVVETYMGEWKKDKRCGHGVAERSDGLKYEGEWYNNRKHGYGVTTFRDGTVEEGKYKNNILITSQKKKHLFL
ARSRKLRDRIAAALSSAQRALKMAMQRSDMAISRMATAAAKAQNADAAAEQARMDCENAVRMAREFAPDFKPSVLERFEK
LRFRERERFRPGPAAASDASVKMGVGLQTQQQQQQQGQFSPTSSSGSDAYATQAQRQQQYLNMQQQQQQQRRMSQQKHES
ECPVPPSMYSQQLPVSPQTDLSGMVSQAQPSHAQVISAINQMYHQQQHQQQQQLNQQQSNPQMNPAYQFQQQQPPGQAKI
NPNLNANLKQNQAPNQNQTQMPFGSGTNQVTVSPQQQQLLQQQQQQQQQQLLQQQQLQQQQQLQQQHQGLQQQPSLHASP
THNASNLLRRASQMQQQQIQETAAAAAMAANAAAMAAAQQQQRSGRPPMLGQMGQQSSIDHFDHYKRPPSRDSSIDRYAR
AASRLSGAFAGSRQASLDRSGIADPVTNGGTSTPDGRPRAGSVFRGSTPQPGAGTSTMTGNGSLPSGNGGGRLSRAGTPS
LGAGGRAPSQGKTEPLFSSPNQPFEDVLLRQRTLGQDIIPSPSQPKRTESLYLPAKPATPVGMAMGGKGGGGGGGKKMKS
VPINVTLQRKKSMPDFQELPRATEAMSREEVSALGSARREAVRRQIEVNERLKANPLLYLVSPQVKDWFVRQQLMLLVLI
FNVALALLFVYMLT
Estimated Isoelectric Point:
9.91216278076172
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys50
Gln146
Leu70
Gly106
Met34
Ser92
Tyr28
His23
Glu47
Arg73
Cys6
Phe26
Pro54
Val38
Asn43
Ala98
Ile25
Trp11
Asp34