Sequence:
download
FLYBASE:CG42775sequence.fasta
>pre-mod(mdg4)-W-PB MLSTLRHLPVEAIFDADGKQMDFIPNIRVIRSQRKTIKLMFKKYAYSKTNEHDTTTYWHCRSRRNGRPACKARFSTKKLK NGSYKVYLTQPEHNHPPKKRRL
view sequence (102 aa)
>pre-mod(mdg4)-W-PB
MLSTLRHLPVEAIFDADGKQMDFIPNIRVIRSQRKTIKLMFKKYAYSKTNEHDTTTYWHCRSRRNGRPACKARFSTKKLK
NGSYKVYLTQPEHNHPPKKRRL
Estimated Isoelectric Point:
10.5058212280273
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys13
Gln3
Leu7
Gly3
Met3
Ser6
Tyr5
His5
Glu3
Arg11
Cys2
Phe4
Pro6
Val3
Asn5
Ala5
Ile5
Trp1
Asp4