Sequence:
download
FLYBASE:CG42774sequence.fasta
>pre-mod(mdg4)-AE-PB MRHSCVCRRNGVTIIDGYRFVIGTTNLRRTYLKCANFRSNCRARAILNTDTNKVRMRHDRHNHSRTDAVSGRISKK
view sequence (76 aa)
>pre-mod(mdg4)-AE-PB
MRHSCVCRRNGVTIIDGYRFVIGTTNLRRTYLKCANFRSNCRARAILNTDTNKVRMRHDRHNHSRTDAVSGRISKK
Estimated Isoelectric Point:
11.4732131958008
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr7
Lys4
Leu3
Gly4
Met2
Ser5
Tyr2
His4
Arg14
Cys4
Phe2
Val5
Asn7
Ala4
Ile5
Asp4