Sequence:
download
FLYBASE:CG42551sequence.fasta
>larp-PH MSSKEETPSTGGAAPVATVAASGSATTSYANVVQNLETKKSGTSNTTTTTARATVDNKENQPNLKSFKSWSEEAAAAEAA GESPIVGSVSLAQTGEKRAAASGGDNTAENSSELDDNNDFVPVLSHHRRDRKKARKEKPRDQQPAGGRGDGQKPQQAGGR RVPGSSDTERKSVRPRAPRGGSPRKSAAGAAGAAGSNAGAVSSAVPGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADGD QQAGEKGAAGAAPPPKRFIAAPPPKVNAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKK TQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKDKKKV NQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNSNPSSST TTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRR FSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAG TGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAA YIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGYK VRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNL VPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEP EGIWKEVKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATK ATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTGRINNFTENFSD DDESDYEFADRDINKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVADYKTVNVISQ ADFEKLAGGRNKSVLPPQVVPPPPPFEEDLDETLVGDTTLNSTLNNTLKSRRARFYAAPNSHSIDPRTPRKRKLRHTANP PVEAHVGWLLDTVEHRPRTTSMGSSAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRR LGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYE TGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQLNRHRSVSESDGTAVI AAGGRRLNTTITNRSDYVGRLLQQQHQQQQQQQHHQYQQGYGGYNQQQNRRRTGSFGSTTVRIRSGSLGNKPQVANRNQG SQHELRRGGSNSGLAPHKRQQQQKPKPGAGSQTGSTRATTSAAATATTAASAATSTAATPAVTVSSGSSSSKK
view sequence (1673 aa)
>larp-PH
MSSKEETPSTGGAAPVATVAASGSATTSYANVVQNLETKKSGTSNTTTTTARATVDNKENQPNLKSFKSWSEEAAAAEAA
GESPIVGSVSLAQTGEKRAAASGGDNTAENSSELDDNNDFVPVLSHHRRDRKKARKEKPRDQQPAGGRGDGQKPQQAGGR
RVPGSSDTERKSVRPRAPRGGSPRKSAAGAAGAAGSNAGAVSSAVPGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADGD
QQAGEKGAAGAAPPPKRFIAAPPPKVNAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKK
TQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKDKKKV
NQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNSNPSSST
TTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRR
FSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAG
TGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAA
YIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGYK
VRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNL
VPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEP
EGIWKEVKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATK
ATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTGRINNFTENFSD
DDESDYEFADRDINKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVADYKTVNVISQ
ADFEKLAGGRNKSVLPPQVVPPPPPFEEDLDETLVGDTTLNSTLNNTLKSRRARFYAAPNSHSIDPRTPRKRKLRHTANP
PVEAHVGWLLDTVEHRPRTTSMGSSAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRR
LGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYE
TGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQLNRHRSVSESDGTAVI
AAGGRRLNTTITNRSDYVGRLLQQQHQQQQQQQHHQYQQGYGGYNQQQNRRRTGSFGSTTVRIRSGSLGNKPQVANRNQG
SQHELRRGGSNSGLAPHKRQQQQKPKPGAGSQTGSTRATTSAAATATTAASAATSTAATPAVTVSSGSSSSKK
Estimated Isoelectric Point:
9.60604095458984
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr160
Lys105
Gln100
Leu84
Gly129
Met11
Ser172
Tyr39
His30
Glu88
Arg98
Cys4
Phe41
Pro109
Val79
Asn98
Ala205
Ile41
Trp11
Asp69