Sequence:
download
FLYBASE:CG42342sequence.fasta
>CG42342-PH MRKHKAPPSGSPRTMAQDNSQSEPSGGNGESPAATTAAAASVEAPQQSLLLGHNAADASAAAVASRLAPPPCQHPINNSN NNSNISNNSSNSSSSKERPRPTVRFISLLHVASYVLCLCAFSFALYGNVRQTRLEQRMQRLQQLDARIVELELRLEQQQL LHWPAEQTQVLASHPSDRDSSNSNNGSQHLELHVRRELHRLRRDVSHLQLTRRQQRRQAAEAAAAAASGEGGSGGGQCQC QPGPPGPPGPPGKRGKRGKKGDSGEKGDPGLNGISGEKGAAGKPGDKGQKGDVGHPGMDVFQTVKGLKRSVTTLHGGTLG YAEIVAVKDLQEAGVNVSASTVIKLKGEPGEPGPPGPPGEAGQPGAPGERGPPGEIGAQGPQGEAGQPGVAGPPGVAGAP GTKGDKGDRGDRGLTTTIKGDEFPTGIIEGPPGPAGPPGPPGEPGARGEPGPIGPAGPPGEKGPRGKRGKRIFGPGGTKI DEDYDDPPVTLLRGPPGPPGIAGKDGRDGRDGSKGEPGEPGEPGSLGPRGLDGLPGEPGIEGPPGLPGYQGPPGEKGDRG DIGPPGLMGPPGLPGPPGYPGVKGDKGDRGDSYRKMRRRQDDGMSDAPHMPTIEYLYGPPGPPGPMGPPGHTGSQGERGL DGRKGDPGEKGHKGDQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEG PRGEQGSRGDAGPPGKRGRKGDRGDKGEQGVPGLDAPCPLGADGLPLPGCGWRPPKEPIISTPVHKDYLPDVTQPESNTS DYEQEEEEDDEQAEDNENEYDEYQDNLHNNE
view sequence (831 aa)
>CG42342-PH
MRKHKAPPSGSPRTMAQDNSQSEPSGGNGESPAATTAAAASVEAPQQSLLLGHNAADASAAAVASRLAPPPCQHPINNSN
NNSNISNNSSNSSSSKERPRPTVRFISLLHVASYVLCLCAFSFALYGNVRQTRLEQRMQRLQQLDARIVELELRLEQQQL
LHWPAEQTQVLASHPSDRDSSNSNNGSQHLELHVRRELHRLRRDVSHLQLTRRQQRRQAAEAAAAAASGEGGSGGGQCQC
QPGPPGPPGPPGKRGKRGKKGDSGEKGDPGLNGISGEKGAAGKPGDKGQKGDVGHPGMDVFQTVKGLKRSVTTLHGGTLG
YAEIVAVKDLQEAGVNVSASTVIKLKGEPGEPGPPGPPGEAGQPGAPGERGPPGEIGAQGPQGEAGQPGVAGPPGVAGAP
GTKGDKGDRGDRGLTTTIKGDEFPTGIIEGPPGPAGPPGPPGEPGARGEPGPIGPAGPPGEKGPRGKRGKRIFGPGGTKI
DEDYDDPPVTLLRGPPGPPGIAGKDGRDGRDGSKGEPGEPGEPGSLGPRGLDGLPGEPGIEGPPGLPGYQGPPGEKGDRG
DIGPPGLMGPPGLPGPPGYPGVKGDKGDRGDSYRKMRRRQDDGMSDAPHMPTIEYLYGPPGPPGPMGPPGHTGSQGERGL
DGRKGDPGEKGHKGDQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEG
PRGEQGSRGDAGPPGKRGRKGDRGDKGEQGVPGLDAPCPLGADGLPLPGCGWRPPKEPIISTPVHKDYLPDVTQPESNTS
DYEQEEEEDDEQAEDNENEYDEYQDNLHNNE
Estimated Isoelectric Point:
5.74961090087891
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys41
Gln42
Leu50
Gly163
Met13
Ser48
Tyr13
His18
Glu57
Arg52
Cys7
Phe6
Pro115
Val26
Asn24
Ala55
Ile22
Trp2
Asp51