Sequence:
download
FLYBASE:CG42321sequence.fasta
>ATP8A-PH MSGSYQRQSLELRSPDHGSVDDPDGCLRNHLGSSASQRRRQQRIAQQRQDSWFRHSMPPAINRDFESLEHLTPRASDGLD EQLAASVSHSVHSGGSVTLCGPPDHSSIHLNSANSNLGFIDSDTPNTPVTPVSGLQPPASVSTSVGGTLSSRRRSSNRKD SKGSILSRQSGKSRVSLLAQRGLRMTASFLRRKRTEYEDDEDFTSSAGYDADDGERRIINLNGPQPTKYGNNRITTAKYS FISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDS GSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIE CELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILM LFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLGYNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEM YHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQNILGRHETSAVIEEFL ELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIV RTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESK LEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDAT REVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQSTNAVTLAI GDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVY SGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLP LAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFR GMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSDSGFGYALGKLIRSS HILISHDHHPVSESSRTSNLRVENLEMEADTEQQQQSRQRQKWRGGQVATGVARSARNSTTSPITATLHM
view sequence (1350 aa)
>ATP8A-PH
MSGSYQRQSLELRSPDHGSVDDPDGCLRNHLGSSASQRRRQQRIAQQRQDSWFRHSMPPAINRDFESLEHLTPRASDGLD
EQLAASVSHSVHSGGSVTLCGPPDHSSIHLNSANSNLGFIDSDTPNTPVTPVSGLQPPASVSTSVGGTLSSRRRSSNRKD
SKGSILSRQSGKSRVSLLAQRGLRMTASFLRRKRTEYEDDEDFTSSAGYDADDGERRIINLNGPQPTKYGNNRITTAKYS
FISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINHRSIERLDS
GSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIE
CELPNRHLYEFNGVLRETGKPPAALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILM
LFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLGYNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEM
YHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQNILGRHETSAVIEEFL
ELLSVCHTVIPERKENGNMIYHAASPDERALVEGAQKFGYIFDTRTPKYVEINALGVRKRYEVLNVLEFTSSRKRMSLIV
RTPENKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESK
LEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDAT
REVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQSTNAVTLAI
GDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVY
SGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLP
LAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLAIWGSIVLWFGFLLIYSHVWPMFKFASNFR
GMDIQLLSTPVFYFCLMLVPITTLLIDVICKLVHNTVFKTLTEAVRETEIRRSDISEVMNEPRSSDSGFGYALGKLIRSS
HILISHDHHPVSESSRTSNLRVENLEMEADTEQQQQSRQRQKWRGGQVATGVARSARNSTTSPITATLHM
Estimated Isoelectric Point:
6.61072540283203
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr89
Lys52
Gln54
Leu149
Gly75
Met29
Ser119
Tyr44
His30
Glu83
Arg86
Cys24
Phe59
Pro46
Val81
Asn63
Ala89
Ile95
Trp22
Asp61