Sequence:
download
FLYBASE:CG34408sequence.fasta
>CG34408-PH MYSEWASLSAQITANSCGAQCFSVLNKFPASAGREVVVSVVKQLGTNLGITQNAEPSHLVKDEEVKWCMDVICFGLSLPL QEHETIKDCVNVYCEWLTALHPQPRISVPKPICEDANLYARQIINHFHNLFVPRQGEILPFLYQTTLGADTIKRQAVLCH RVLRTLQQTAQISQLMDRQTWDTLLLFLLAINEILLAPPTVKDDVGDQLCERVLSVLFEVWLLACVRSFPSPSMWKTLQE SCAMWRHRVALVDQWNRVNLALTARLLEFSYGPAFPQLKNADEDGQLIPIGMSNDCVAQTWYRFLRMIGNPTALCSPHII SKSSHFVQWALTHEKGAETHQHPCLQQLPQIFLNAMKGISSQVDAFLGVYQPPPQQTDGVVTNLLEIRHSLNEATSSTLQ QFIHSSSATNIANQQNQPAHHHHHLHYPHLHLHGAGSFLRDNFMSNSASSALNAIMGHHGGHHGHHHQQQQQQQQQLQIS ASPTSSLTTSGSSAVGSTSAGGSHSAGVVGSISFGATESPGPGQASASATPTPPLQRRLAKSFSVAPTITQQKGLSKTSL IGLTGGGARNAISSSSTTTTNAGSTGGTGSGDGSAPAPLPTTPTSTSGPPSASSSINSLPLTSMGAGVELAVARPKCNSI LHVFHEWLFEAAHIGGDTWRQNRKKQACEASKRPSSMIMEHRKGSISLSQPNSLNDPQSLPPTLTIDKYESGRAEAIGTL CKIFCAKKTGEEILPVYLARFYMALQQCLKITESRECDETLASILLHSSDLFRLDLDGINVLLPGFIAALEIVLPDKDLK LKTQSMVFNRTELRRSAINILLSIMVLPLHYQTLPIRDLTCESSEKMFTFIQLKSRLMNILMNALQVETDAQNTHMLLGG LLLCVQDAVTFEETELGGGNANLSQNSSGVQHHDANLLSSACSERSASLVSAGTASLGGQTTATMGAGSGSIRDTASAHD YPSLTISDDMSFEFGQELEGVTTYDNAHALFVRATYLVCHRLISSWKTDLNVSLAALELLSGLARLHIRETDALECKRAV KWICDYICYQCSRPPPAHSKDLHSTIVAAFQCTAAWLMQHPYLLQDKDCLQTVLEVVELGISGTKSQSKGTDIPKFKDEK ELKPASMRVRDAAENLLTIILEQVGYFPSECGPESISSLLDELALMKHCNSMVPAAAASSEQAIAKFKYFVTENSTILAL LEEPLGNDQDPQPTVTLLIRGPFGRHAWTMQLRHLPRSKSGIKYHAINPGRPIPMNDVTQRLDSEQKNFPDGVDKVQPCV ADYSIPTIEQMREQYGTAVIRELESLLENQSIHEKLAWAEADTSADSLSHAQECVPPTVCHEFHAARLFLSHFGFLGFET RNPQNPAEALGNPPQRPLIVLDTKSAAFAADLDRLDKLSARTHDSVYVFYVKSGQTSAQQIIANMGEESSASHDPHFASM LQTLGWPVQVSEHSGWTGFAHNSWSLKGTPEEQLKSTANELNYNGSQRVLYWADVSSEIAFVVPTTWNLRYNSDTCDSGS ISSTDQIGSSNVWTRGEADSAAGLAKSKSRNLSLELDTNRRDVKEPVPPTRRKGNVTKPTLLAQAPAKIFLVWLESYEDY LNFPLEDLLAYTRTGEELQTQQLPRASDCHVIFVHSLLSGLLRVKLQGPPGRMSFATPLVDGMVLSRRVVGNLVRQTALN ISRRRRLDNDNYQPPHVRRRLKVQDIVQKYKMDLSEADLLAHLFQRAI
view sequence (1728 aa)
>CG34408-PH
MYSEWASLSAQITANSCGAQCFSVLNKFPASAGREVVVSVVKQLGTNLGITQNAEPSHLVKDEEVKWCMDVICFGLSLPL
QEHETIKDCVNVYCEWLTALHPQPRISVPKPICEDANLYARQIINHFHNLFVPRQGEILPFLYQTTLGADTIKRQAVLCH
RVLRTLQQTAQISQLMDRQTWDTLLLFLLAINEILLAPPTVKDDVGDQLCERVLSVLFEVWLLACVRSFPSPSMWKTLQE
SCAMWRHRVALVDQWNRVNLALTARLLEFSYGPAFPQLKNADEDGQLIPIGMSNDCVAQTWYRFLRMIGNPTALCSPHII
SKSSHFVQWALTHEKGAETHQHPCLQQLPQIFLNAMKGISSQVDAFLGVYQPPPQQTDGVVTNLLEIRHSLNEATSSTLQ
QFIHSSSATNIANQQNQPAHHHHHLHYPHLHLHGAGSFLRDNFMSNSASSALNAIMGHHGGHHGHHHQQQQQQQQQLQIS
ASPTSSLTTSGSSAVGSTSAGGSHSAGVVGSISFGATESPGPGQASASATPTPPLQRRLAKSFSVAPTITQQKGLSKTSL
IGLTGGGARNAISSSSTTTTNAGSTGGTGSGDGSAPAPLPTTPTSTSGPPSASSSINSLPLTSMGAGVELAVARPKCNSI
LHVFHEWLFEAAHIGGDTWRQNRKKQACEASKRPSSMIMEHRKGSISLSQPNSLNDPQSLPPTLTIDKYESGRAEAIGTL
CKIFCAKKTGEEILPVYLARFYMALQQCLKITESRECDETLASILLHSSDLFRLDLDGINVLLPGFIAALEIVLPDKDLK
LKTQSMVFNRTELRRSAINILLSIMVLPLHYQTLPIRDLTCESSEKMFTFIQLKSRLMNILMNALQVETDAQNTHMLLGG
LLLCVQDAVTFEETELGGGNANLSQNSSGVQHHDANLLSSACSERSASLVSAGTASLGGQTTATMGAGSGSIRDTASAHD
YPSLTISDDMSFEFGQELEGVTTYDNAHALFVRATYLVCHRLISSWKTDLNVSLAALELLSGLARLHIRETDALECKRAV
KWICDYICYQCSRPPPAHSKDLHSTIVAAFQCTAAWLMQHPYLLQDKDCLQTVLEVVELGISGTKSQSKGTDIPKFKDEK
ELKPASMRVRDAAENLLTIILEQVGYFPSECGPESISSLLDELALMKHCNSMVPAAAASSEQAIAKFKYFVTENSTILAL
LEEPLGNDQDPQPTVTLLIRGPFGRHAWTMQLRHLPRSKSGIKYHAINPGRPIPMNDVTQRLDSEQKNFPDGVDKVQPCV
ADYSIPTIEQMREQYGTAVIRELESLLENQSIHEKLAWAEADTSADSLSHAQECVPPTVCHEFHAARLFLSHFGFLGFET
RNPQNPAEALGNPPQRPLIVLDTKSAAFAADLDRLDKLSARTHDSVYVFYVKSGQTSAQQIIANMGEESSASHDPHFASM
LQTLGWPVQVSEHSGWTGFAHNSWSLKGTPEEQLKSTANELNYNGSQRVLYWADVSSEIAFVVPTTWNLRYNSDTCDSGS
ISSTDQIGSSNVWTRGEADSAAGLAKSKSRNLSLELDTNRRDVKEPVPPTRRKGNVTKPTLLAQAPAKIFLVWLESYEDY
LNFPLEDLLAYTRTGEELQTQQLPRASDCHVIFVHSLLSGLLRVKLQGPPGRMSFATPLVDGMVLSRRVVGNLVRQTALN
ISRRRRLDNDNYQPPHVRRRLKVQDIVQKYKMDLSEADLLAHLFQRAI
Estimated Isoelectric Point:
6.36826324462891
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr111
Lys65
Gln103
Leu198
Gly101
Met34
Ser171
Tyr33
His65
Glu89
Arg81
Cys37
Phe55
Pro94
Val94
Asn69
Ala145
Ile82
Trp24
Asp77