Sequence:
download
FLYBASE:CG34398sequence.fasta
>CG34398-PH MEVATTNNHSQSHHHHHHHLQPTAVVGAAGGSRSPFQREVREWQRIDPNTGALFSGRLEADRWINGPLNSYGKISDSQNI SQPNGTQHTQRKQLEVLKARTANGAMQVIRTQTVQKSSSSWSSSTSTTTTSTTHQRTSQTNGHDPPPKSTILSPISQGVD ICELSDDCSLSGSDAGIVHTPFAATSASASASATALSQELIDDHVDFVVINGEASDKEDAADEPLHNGCHNLLPDTAPSL KLSNLMKSSSSISSQSSNNSNLTTATQAASNTHRSAGKISLHAIVGPESSLSSSSTPSSAVWAKQADLYGQLPSGVGGSG GAGGADVAVAPPTQRRDLESFRHYNDDDDDDNNLRLTARHQRRQQVSQSVYAPPLPSIGSTLLQRSRSISTDDLSNDWER EDPAEQPVGEWRRVSKLRRSFQSQDHYKSPATSARPRPLDLPSNSVSVARLRAELENGRRLHTAMRNNHVDLAALDNILN TPSAKPTVAKRNTFLTAESLQEIRGKLKKLSDENLYKEDFLAYHQKKPVVVREISVEKVDPTPPAQSTPSAFRPVHNTHS LESRQRQKDTSSSEWHLRRKSYGFEKMSPPEDKSICRVDASTDSGLGRSGEQLGNWSPTERERERNEKNAAAAQQQNGVG TIVHFGRSLKPIIPSSSPTEGELSKRHSIAVEETWRDVRKTSQVHVNGGTAVTSSSHTTTSHLSKGSAQKRVEFCKTEVH FAAESGRVNIVETDGKPPPTQNFRRRRRSNTTTTTSGPLQSLVKSASTVGGGSSTSSTASSEVTHFGDDSQRRKTIATTT VAYRATLMDPPEVVSQPISSSSNSTSSSTQVTVTTVAKPVHEPRYSLMESTSRNSYTSTSGVDTTDNETDELSNIRGILK NKPVKPKPYHLGENIDSADVLWSVPAMKADRESPSARDSGITSDSPISPKSVAERIRIVEQRQQQQQSSPAGNGYSTKIN VSLGSEDWAESGTAMHHHPSSKYRQHRRPSAQELLLEDLRQHQRILDEGLKSTSLIMRTMRSASEFDEAMRRLSIASIES ALVQPTIVVPTPMLRSHSYQEEGSYSSSRRPSTISTTSITSSDLFGSALYDSLPRTPLAPPRLKLLGNTQIPVSQQLTQL RRLYDAAEQDQEDSADEEVKRYFRDSNSDSGGGTQGSSSPDQQPTETFKGSEYSSSWSRLKAKRTIWKIEAQDQMLKRAD LPKSNVMNIALHAPQIEKPKATPPTLRIDQLIPVAKPRTLFIQPQLQAQSTVDNADESGSESLKIVKEARGARKLREHEL SYFGVQHKQQQQTKLSTTTTTNPRRTLPSRSKVSHSDEVKANTTTTTKWQLLNDRPDLLRHSSPHHNDNGTANDYNHNDD DLDDDEEHCYENIATELTTTFRVKSPDHSPNRSRSPGSYERKSDLQRDAQILSEMTRNADQTLKALSDEAAIKDQRRRSC SLQRRSAKPLETIDEKVKVYPQSMGVARGTFASEARRNSRQSTPSPSRARSSSQSSIECCPRDRSRSSSRESMTHGGGSS DDQVATKQRAERLRMRTPKREKSRHEPIEVRVHRNSSKPRSSSSATGAGSSSLESKRSSHHSRHSRELDQSTETKTSSSS RLIRSSRVADESRSRQSSHRDREKERDRERSRGTEKHRDELTRSRGHSSRSRHSEHPSSGSRESRRPSKTRSSRSIHDSA TIHKKSTTSTTASSKASKTTAHKPSASASASTTTAPPTHHHELTYVYVTNLANTETTDESPEQHSAESADGPAKEADYAS IDEVESVTKAPQPPPRSKRKRSLIPVPVNPPASYEYRTKLQMIPPSYSNQSTLRCRSVARKKPSLKATQSTSSSFAFLPY LPAKRNSSVSHVYDNYLLYATSEELGKADKLRPYQNNLSNEHAQLFGASATGAAAREGRGRLGGWPKRLKMRQVRSSVST HQPFGICTCS
view sequence (1930 aa)
>CG34398-PH
MEVATTNNHSQSHHHHHHHLQPTAVVGAAGGSRSPFQREVREWQRIDPNTGALFSGRLEADRWINGPLNSYGKISDSQNI
SQPNGTQHTQRKQLEVLKARTANGAMQVIRTQTVQKSSSSWSSSTSTTTTSTTHQRTSQTNGHDPPPKSTILSPISQGVD
ICELSDDCSLSGSDAGIVHTPFAATSASASASATALSQELIDDHVDFVVINGEASDKEDAADEPLHNGCHNLLPDTAPSL
KLSNLMKSSSSISSQSSNNSNLTTATQAASNTHRSAGKISLHAIVGPESSLSSSSTPSSAVWAKQADLYGQLPSGVGGSG
GAGGADVAVAPPTQRRDLESFRHYNDDDDDDNNLRLTARHQRRQQVSQSVYAPPLPSIGSTLLQRSRSISTDDLSNDWER
EDPAEQPVGEWRRVSKLRRSFQSQDHYKSPATSARPRPLDLPSNSVSVARLRAELENGRRLHTAMRNNHVDLAALDNILN
TPSAKPTVAKRNTFLTAESLQEIRGKLKKLSDENLYKEDFLAYHQKKPVVVREISVEKVDPTPPAQSTPSAFRPVHNTHS
LESRQRQKDTSSSEWHLRRKSYGFEKMSPPEDKSICRVDASTDSGLGRSGEQLGNWSPTERERERNEKNAAAAQQQNGVG
TIVHFGRSLKPIIPSSSPTEGELSKRHSIAVEETWRDVRKTSQVHVNGGTAVTSSSHTTTSHLSKGSAQKRVEFCKTEVH
FAAESGRVNIVETDGKPPPTQNFRRRRRSNTTTTTSGPLQSLVKSASTVGGGSSTSSTASSEVTHFGDDSQRRKTIATTT
VAYRATLMDPPEVVSQPISSSSNSTSSSTQVTVTTVAKPVHEPRYSLMESTSRNSYTSTSGVDTTDNETDELSNIRGILK
NKPVKPKPYHLGENIDSADVLWSVPAMKADRESPSARDSGITSDSPISPKSVAERIRIVEQRQQQQQSSPAGNGYSTKIN
VSLGSEDWAESGTAMHHHPSSKYRQHRRPSAQELLLEDLRQHQRILDEGLKSTSLIMRTMRSASEFDEAMRRLSIASIES
ALVQPTIVVPTPMLRSHSYQEEGSYSSSRRPSTISTTSITSSDLFGSALYDSLPRTPLAPPRLKLLGNTQIPVSQQLTQL
RRLYDAAEQDQEDSADEEVKRYFRDSNSDSGGGTQGSSSPDQQPTETFKGSEYSSSWSRLKAKRTIWKIEAQDQMLKRAD
LPKSNVMNIALHAPQIEKPKATPPTLRIDQLIPVAKPRTLFIQPQLQAQSTVDNADESGSESLKIVKEARGARKLREHEL
SYFGVQHKQQQQTKLSTTTTTNPRRTLPSRSKVSHSDEVKANTTTTTKWQLLNDRPDLLRHSSPHHNDNGTANDYNHNDD
DLDDDEEHCYENIATELTTTFRVKSPDHSPNRSRSPGSYERKSDLQRDAQILSEMTRNADQTLKALSDEAAIKDQRRRSC
SLQRRSAKPLETIDEKVKVYPQSMGVARGTFASEARRNSRQSTPSPSRARSSSQSSIECCPRDRSRSSSRESMTHGGGSS
DDQVATKQRAERLRMRTPKREKSRHEPIEVRVHRNSSKPRSSSSATGAGSSSLESKRSSHHSRHSRELDQSTETKTSSSS
RLIRSSRVADESRSRQSSHRDREKERDRERSRGTEKHRDELTRSRGHSSRSRHSEHPSSGSRESRRPSKTRSSRSIHDSA
TIHKKSTTSTTASSKASKTTAHKPSASASASTTTAPPTHHHELTYVYVTNLANTETTDESPEQHSAESADGPAKEADYAS
IDEVESVTKAPQPPPRSKRKRSLIPVPVNPPASYEYRTKLQMIPPSYSNQSTLRCRSVARKKPSLKATQSTSSSFAFLPY
LPAKRNSSVSHVYDNYLLYATSEELGKADKLRPYQNNLSNEHAQLFGASATGAAAREGRGRLGGWPKRLKMRQVRSSVST
HQPFGICTCS
Estimated Isoelectric Point:
9.56481170654297
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr160
Lys98
Gln101
Leu126
Gly89
Met21
Ser303
Tyr36
His72
Glu115
Arg167
Cys12
Phe27
Pro117
Val91
Asn73
Ala140
Ile64
Trp15
Asp103