Sequence:
download
FLYBASE:CG34356sequence.fasta
>bma-PH MPAGTMFAKFKSTNVAASTATQAVADGNPITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPR RKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQA AANTLPQRPAHAKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERMNENDLNSSI PCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNGRPLIQAGNSTSNYAKQMETLDDLVHKLMPR LPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWP MLKSEINNNEVLAAVLQPVMLFVQEATLTEYDTLMSATMKVIYNTPKSIQASVTILENLHLIIEKTKPEDVTTDIMPMLF YSFDGSTIQVQSAAVVAVANVFDSIDELSIRRMVLPKVKQVFEKNITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLA NIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQQRNKLKLD NLSMASPERHRTLRHQFSTDNMNAPPFNIPNLRIDQRKTSSAEDMARKNSGGSGMLGGWWFGCSPSSPDSNFLRVGNVFP NRRLSDNTLMTPKIRIAPSCASSPGGTPGSGLPTRRHSSIGPQERRGSTINLSPPTGGSMPNTSSSVPFLLSSSMQSIRS RRQSTVLSSGPLGSGSGLLQQLGSGMVRQLTSVSGTVSPVPLLRVNGTRNSHSNVRKCPSLNITFSQXYDLNEIGEATAN ADSSRYGSASTSNFNTGYNTGYNYGPQSYGPQTYGHNLNQSLNNVRYKAKLRSMNLNLNPPRN
view sequence (943 aa)
>bma-PH
MPAGTMFAKFKSTNVAASTATQAVADGNPITQYFEIGKPVACAGPELVWRIHDAYRKSDNKECSVFIFEKKIAEKLHKPR
RKETITELLKSSVKTLERFRHPRILQIYHTVEESADTLAFASEPIFASLSNVLAFHESKTYEATNVAPAAGGAAASQAQA
AANTLPQRPAHAKEYNFLDMELKYGFLQLTEALAYLHYSGHVIHRNVCPSSILITKRGIWKLAGMEYVERMNENDLNSSI
PCPPWSNRVSKMAQPNLDFMAPETQSTSKCSLLSDMFSLGMVICAVFNNGRPLIQAGNSTSNYAKQMETLDDLVHKLMPR
LPIALQEATSRMASRDATARPTAQLLQLIKYFIDTPINALKFLDVVNMKDTQQKSQFYKTTLIEAMPMIPRKLWWQNIWP
MLKSEINNNEVLAAVLQPVMLFVQEATLTEYDTLMSATMKVIYNTPKSIQASVTILENLHLIIEKTKPEDVTTDIMPMLF
YSFDGSTIQVQSAAVVAVANVFDSIDELSIRRMVLPKVKQVFEKNITDPKIVQNVLMCIERVMDRMERAQVMDEVLPLLA
NIRIPDPDIIMRTVRIYHKLFVDKTYGLTVETMATNVLPLLIPHTVNPSLNFEQYCYLLEVLQQMLEAIDRQQRNKLKLD
NLSMASPERHRTLRHQFSTDNMNAPPFNIPNLRIDQRKTSSAEDMARKNSGGSGMLGGWWFGCSPSSPDSNFLRVGNVFP
NRRLSDNTLMTPKIRIAPSCASSPGGTPGSGLPTRRHSSIGPQERRGSTINLSPPTGGSMPNTSSSVPFLLSSSMQSIRS
RRQSTVLSSGPLGSGSGLLQQLGSGMVRQLTSVSGTVSPVPLLRVNGTRNSHSNVRKCPSLNITFSQXYDLNEIGEATAN
ADSSRYGSASTSNFNTGYNTGYNYGPQSYGPQTYGHNLNQSLNNVRYKAKLRSMNLNLNPPRN
Estimated Isoelectric Point:
9.28058624267578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr63
Lys46
Gln43
Leu90
Gly45
Met38
Ser89
Tyr27
His18
Glu44
Arg53
Cys11
Phe32
Pro61
Val55
Xaa**1
Asn63
Ala69
Ile52
Trp8
Asp35