Sequence:
download
FLYBASE:CG33196sequence.fasta
>dpy-PQ MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNESTEYLQLFNLSKLCDGTQDC FLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYR GNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSF RCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAP YQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC IENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQ NEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHA QCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDAN PCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQC VNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKC TPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQL GNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGC GENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICD AGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFF GNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQK HHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCP PSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCART ISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIE NKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASA RCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGF LGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAIC TCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQY CQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCG ENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNED CPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRD SMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAA CSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIAC GRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKC QNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKE CVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKC TEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIEC KSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELT CAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTSCAG GVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQRIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGP YTTTTESYKTTKQLSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTLPSRSTDRTTPSESPETPTIL PSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEES TLPSRSTDRTTPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASL ETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTT ESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFR TTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTN VPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFIT RPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS TDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPS VTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDV PTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEE STLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTG GQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTE STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSES PETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNV PIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEAS TPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESPETPTTLPSDFTTRPHSEKT TESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPS ESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTN VPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFET STPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRPHSEQT TESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPS ESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT NVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFE ASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSR STDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQ TTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRD VPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETP TTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPVTSETTTNVPIGS TGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSP ASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTGGQVAGQTTAPPSEVRTTIRV EESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS TGGQLTEQSTSSPSEVRTTIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTI PPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGR SSDVVTERTMPSNISSTTTVFNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCS AEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNSTSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTT TTSSTSTESSTITSATNQTSKNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCAPNEHCKLGHCRKKEPPGSPK TPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTE ACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPG YNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCL PEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCV VAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNP GIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPE CVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAEC KRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGG GARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPE CTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPF DGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFN AKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVR NGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVE RPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNA RCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPE CSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALC EERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVG CHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPG TCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRA PNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPC GANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFT GNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPG TCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPN CRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCG PNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTG NPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDP CPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGR PPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNP SPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFD GYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDP CRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTC RPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCG PHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPG YTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDP CQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFI GAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPC NPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGY EGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFG SPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCG PNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTG DPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCA KTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIG APPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDP CDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQG YTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPG ACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR PECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSN AVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDP YRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPC PGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGA PPNCRPECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCN PSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTA GSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTC GVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCR PECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNA VCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPY RQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADT CGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAP NCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPS PCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGN AFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCG FNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECI SNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEE RGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICR ITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQ AECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPE CSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCG SNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFI QCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRG AQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVT SSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSR QDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVP EPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRV VNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRIN AECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCN NGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTP PPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVN HNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECP SNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGAC QCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIV HEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNH SPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINA ECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQ GECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQL DVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNH SPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQV HVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSC QCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIR EYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHA PLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECL SSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQC SCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLA PPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAP ICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKA CLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQC LPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKE YINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAP ICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSH LSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNC LPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRD VIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSP NCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLA CLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLP EFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVP SRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPH CSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCAS HLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSC LPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVP LNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPH CSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLA CIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCL PEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVV HFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRA YCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCP SHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNG VCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQ APVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVIN HSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSEC PSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEP NPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFS GYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVD PCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQP IYPTPQSPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVF ITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIP VQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPS APQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQA PVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYD VYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPG IVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQ PLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQ DTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQ AIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSL ACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCS CIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPP APAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCP GACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF CRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCG VNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVG NPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC PGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGA APNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQP SPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTG NAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPC PGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPP NCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYP SPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCP PGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKC VDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDC SRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRN PCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNH RARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPT QPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQ CQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQD PCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQN HQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQ CDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKV ISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDC PRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASP CNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCR CPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPV EPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQD CPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCG PNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVD FLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPT PGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRN QLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCK VYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLE GYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCP IDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNH TNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVA SFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKL QVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRV CFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDI CVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
view sequence (22949 aa)
>dpy-PQ
MKIFLPLVTWIVLLLSSAVHSQYSQQPQPFKTNLRANSRFRGEVFYLNLENGYFGCQVNESTEYLQLFNLSKLCDGTQDC
FLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYR
GNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP
DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSF
RCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAP
YQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFV
CTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC
IENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQ
NEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKC
GAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHA
QCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDAN
PCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEI
CNTPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQC
VNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKC
TPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC
ASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQL
GNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGC
GENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK
PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICD
AGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFF
GNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNP
VVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQK
HHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCP
PSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKC
PPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCART
ISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIE
NKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAV
GERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASA
RCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGF
LGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ
PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAIC
TCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQY
CQQDGQCAQGSICSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLS
DAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCG
ENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNED
CPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSV
CKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRD
SMCLPVCHNDLECASNEKCLKGSCMLTCRVDNDCFLGHVCLHNKCVYGCHVDDDCSASESCRNDKCVNPCLENPCGPNAA
CSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDN
ECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIAC
GRNEDCQSNQLCYAGSCQGKCRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTGCRTDLSCATDEACVNKKC
QNPCRTPGQCGQCADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQQCARGKC
RNKCGPKRQCTVGQLCERGACIAGCKSNGDCAADQSCVNGKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKE
CVQFECRVDTDCDSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGNPTSECRPLEGGCSSKPCGENSKC
TEVPGGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHVLENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRT
LGCEVGGCVRQGYEYVCQQDTEQCYSDTDCPSEKSCLQGHCSDPCTMRGVCGLNALCKTVLHRPRCSCPSCHIGRPEIEC
KSDPKCVAEDTDPKTKEQIPCSTDSECPETLQCGQYGQCTDPCNNPLFICESNKKCETRRHQPVCICKSGFIVNEYGELT
CAPDKRECYRDDDCASNMACSDGKCRNPCIVPLGRAAICAENKSCEVQNHKPVCICMRDCQPSISICLRDAGCPASQACR
KLKCVDPCEFATCAPNSPCIVEDHKPICKFCPAGFIADAKNGCQKAKPGGNCTSNTDCSQAHQCGSSGKCIDPCLTSCAG
GVKCVVSAHRVTICTCPATLTNNTDSNCTSTDITVGTTTQRIETTTDFINVKYTVMQLANQTEMRTRFTDIEAENETTGP
YTTTTESYKTTKQLSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSESTTREVYT
IKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTTIRVEESTLPSRSTDRTTPSESPETPTIL
PSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNDPIGSTGGQVTEQTTSSPSEVRTTIGLEES
TLPSRSTDRTTPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGG
QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASL
ETTVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTT
ESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSE
SPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFR
TTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTN
VPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA
STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS
TDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQT
TSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPS
VTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDV
PTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPT
LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEE
STLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTG
GQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASL
ETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTE
STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSES
PETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT
TIGVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNV
PIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEAS
TPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITR
PHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESPETPTTLPSDFTTRPHSEKT
TESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPS
ESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVR
TTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTN
VPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFET
STPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFIT
RPHSEKTTESTRDVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRPHSEQT
TESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPS
ESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV
RTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTT
NVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFE
ASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFI
TRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSR
STDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQ
TTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLETAVP
PVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRD
VPTTRPFESSTPRPVTLEIAVPPVTSETTTNVAIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETP
TTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV
EESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPVTSETTTNVPIGS
TGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSP
ASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD
QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTTNVPIGSTVTSETTTNVPIGSTGGQVAGQTTAPPSEVRTTIRV
EESTLPSRSADRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGS
TGGQLTEQSTSSPSEVRTTIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVLTTRPFETSTPSP
VSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTI
PPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGR
SSDVVTERTMPSNISSTTTVFNNSEPVSDNLPTTISITVTDSPTTVPVPTCKTDYDCLDEQTCIGGQCISPCEYFTNLCT
VQNLTICRTLNHTTKCYCDTDDDVNRPDCSMKAEIGCASSDECPSQQACINALCVDPCTFNNPCSRNEDCRVFNHQPLCS
AEHGRTPGCEHCPPGANCDPTTGACIKANVTITTITTKNSTSTKIPTKPRTTANPNTGVKTTPTTTRVTTRNTTTTTTTT
TTSSTSTESSTITSATNQTSKNQKPDTESTTSHTDATRRYRDGENNITDTPTPRPTIQTTTLRGEGVMGDSQRRSTTTPK
MKTTRLDTSNEVPDTTSPWPIELPTTEGTTTEVYNTMFAPVVNTTDTSLINPCTVDTNCAPNEHCKLGHCRKKEPPGSPK
TPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTE
ACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQED
SCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPG
YNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCL
PEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHP
VCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCV
VAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNP
GIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICG
INAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPE
CVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAEC
KRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIA
CNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGG
GARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPE
CTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAV
CTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPF
DGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFN
AKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN
QDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVR
NGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVE
RPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNA
RCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPE
CSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALC
EERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVG
CHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPG
TCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRA
PNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPC
GANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFT
GNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPG
TCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPN
CRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCG
PNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTG
NPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDP
CPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGR
PPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNP
SPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFD
GYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDP
CRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTC
RPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCG
PHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPG
YTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDP
CQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFI
GAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPC
NPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGY
EGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPC
AAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFG
SPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCG
PNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTG
DPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCA
KTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIG
APPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDP
CDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQG
YTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPG
ACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCR
PECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSN
AVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDP
YRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPC
PGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGA
PPNCRPECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCN
PSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTA
GSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTC
GVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCR
PECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNA
VCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPY
RQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADT
CGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAP
NCRPECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPS
PCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGN
AFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCG
FNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECI
SNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEE
RGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICR
ITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQ
AECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPE
CSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCG
SNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFI
QCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRG
AQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVT
SSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSR
QDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVP
EPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRV
VNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRIN
AECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCN
NGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTP
PPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVN
HNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECP
SNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGAC
QCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIV
HEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNH
SPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINA
ECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQ
GECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQL
DVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNH
SPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQV
HVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSC
QCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVRNHLPTCNCLSGYVGDPYRYCSIEPKPIR
EYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHA
PLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECL
SSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQC
SCIPEYQGDPYTGCRPECVLNADCPRNRACVRHKCVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLA
PPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNCRPECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAP
ICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRPECITNSECSFDKA
CLNQRCRDPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQC
LPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKE
YINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAP
ICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSH
LSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNC
LPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRD
VIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSP
NCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLA
CLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLP
EFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVP
SRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPH
CSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCAS
HLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSC
LPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVP
LNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPH
CSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLA
CIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCL
PEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVV
HFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPNDKACVSRRCTDPCAGACGQNAICRAHQHRA
YCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCP
SHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNG
VCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQ
APVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVIN
HSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSEC
PSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEP
NPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFS
GYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVD
PCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPKPVRPQIYDTPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQP
IYPTPQSPQYNVNYPSPQPANPQKPGVVNIPSVPQPVYPSPQPPVYDVNYPTTPVSQHPGVVNIPSAPRLVPPTSQRPVF
ITSPGNLSPTPQPGVINIPSVSQPGYPTPQSPIYDANYPTTQSPIPQQPGVVNIPSVPSPSYPAPNPPVNYPTQPSPQIP
VQPGVINIPSAPLPTTPPQHPPVFIPSPESPSPAPKPGVINIPSVTHPEYPTSQVPVYDVNYSTTPSPIPQKPGVVNIPS
APQPVHPAPNPPVHEFNYPTPPAVPQQPGVLNIPSYPTPVAPTPQSPIYIPSQEQPKPTTRPSVINVPSVPQPAYPTPQA
PVYDVNYPTSPSVIPHQPGVVNIPSVPLPAPPVKQRPVFVPSPVHPTPAPQPGVVNIPSVAQPVHPTYQPPVVERPAIYD
VYYPPPPSRPGVINIPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTYPHRNPPIQDVTYPAPQPSPPVPG
IVNIPSLPQPVSTPTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPGIINIPSVPQ
PLPSPTPGVINIPQQPTPPPLVQQPGIINIPSVQQPSTPTTQHPIQDVQYETQRPQPTPGVINIPSVSQPTYPTQKPSYQ
DTSYPTVQPKPPVSGIINIPSVPQPVPSLTPGVINLPSEPSYSAPIPKPGIINVPSIPEPIPSIPQNPVQEVYHDTQKPQ
AIPGVVNVPSAPQPTPGRPYYDVAKPDFEFNPCYPSPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSL
ACINEKCRDPCPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCS
CIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPP
APAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCP
GACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPF
CRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCG
VNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVG
NPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC
PGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGA
APNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQP
SPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTG
NAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPC
PGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPP
NCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYP
SPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCP
PGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKC
VDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDC
SRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRN
PCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNH
RARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPT
QPEGCTMDAECPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQ
CQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQD
PCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQN
HQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQ
CDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKV
ISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDC
PRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASP
CNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCR
CPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPV
EPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQD
CPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCG
PNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVD
FLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPT
PGIKEVGGCISDSDCPTDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRN
QLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCK
VYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLE
GYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCP
IDLGYRLTPRGECQPEEPPECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCNH
TNFRTDFPRPDMVVSCLADGVQVEIHITEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHFGSCGMQAVKDVA
SFVLVIQKHPKLVTYKAQAYNIKCVYQTGEKNVTLGFNVSMLTTAGTIANTGPPPICQMRIITNEGEEINSAEIGDNLKL
QVDVEPATIYGGFARSCIAKTMEDNVQNEYLVTDENGCATDTSIFGNWEYNPDTNSLLASFNAFKFPSSDNIRFQCNIRV
CFGRCQPVNCGGYNAFGRRRRSIADNSTDATAIATNSGVEGQLREEITISSNAILTFEKRSGQGLNDANIKPAAQRVEDI
CVSMVGLIIALVITALLALVAVAVAVSCWLMAYRRRPKTIAPLPHPPEFPNPLFSNPDAVPEPTPDYIS
Estimated Isoelectric Point:
5.12198638916016
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr1867
Lys483
Gln1054
Leu833
Gly1538
Met110
Ser1867
Tyr474
His445
Glu1312
Arg1168
Cys2647
Phe436
Pro2863
Val1385
Asn1306
Ala1274
Ile835
Trp11
Asp1041