Sequence:
download
FLYBASE:CG31689sequence.fasta
>CG31689-PH MEKLTQEFALRTMPDFATSSPFNIIFEDLYYRVEVGKDREKKSVLKGIKGTFKSGELTAIMGPSGAGKSSLMNILTGLTK SGVSGKIEIGKARKLCGYIMQDDHFFPYFTVEETMLMAATLKISNQCVSLKEKRTLIDYLLNSLKLTKTRQTKCSNLSGG QKKRLSIALELIDNPAVLFLDEPTTGLDSSSSFDTIQLLRGLANEGRTIVCTIHQPSTNIYNLFNLVYVLSAGRCTYQGT PQNTVMFLSSVGLECPPYHNPADFLLECANGDYGDQTEALAEAAKDIRWRYDQQLMQGEDADAPSETQVAKFNESQSPGQ VQVQVQKIEIQNMESSKDLTKHTYPPTEYMRLWLLIGRCHLQFFRDWTLTYLKLGIHVLCSILIGLFFGDSGSNATKQIS NVGMIMIHCVYLWYTTIMPGILRYPAEIEIIRKETFNNWYKLRTYYLATIITSTPVHIIFSTVYITIGYLMTDQPVEMDR FVKYLLSAVVVTICADGLGVFLGTVLNPVNGTFVGAVSTSCMLMFSGFLILLNHIPAAMRFMAYISPLRYALENMVISLY GNQRGQLICPPTEFYCHFKNAVTVLRQFGMEDGDFGHNILMILIQIAIFKVLSYFTLKHKIKTN
view sequence (624 aa)
>CG31689-PH
MEKLTQEFALRTMPDFATSSPFNIIFEDLYYRVEVGKDREKKSVLKGIKGTFKSGELTAIMGPSGAGKSSLMNILTGLTK
SGVSGKIEIGKARKLCGYIMQDDHFFPYFTVEETMLMAATLKISNQCVSLKEKRTLIDYLLNSLKLTKTRQTKCSNLSGG
QKKRLSIALELIDNPAVLFLDEPTTGLDSSSSFDTIQLLRGLANEGRTIVCTIHQPSTNIYNLFNLVYVLSAGRCTYQGT
PQNTVMFLSSVGLECPPYHNPADFLLECANGDYGDQTEALAEAAKDIRWRYDQQLMQGEDADAPSETQVAKFNESQSPGQ
VQVQVQKIEIQNMESSKDLTKHTYPPTEYMRLWLLIGRCHLQFFRDWTLTYLKLGIHVLCSILIGLFFGDSGSNATKQIS
NVGMIMIHCVYLWYTTIMPGILRYPAEIEIIRKETFNNWYKLRTYYLATIITSTPVHIIFSTVYITIGYLMTDQPVEMDR
FVKYLLSAVVVTICADGLGVFLGTVLNPVNGTFVGAVSTSCMLMFSGFLILLNHIPAAMRFMAYISPLRYALENMVISLY
GNQRGQLICPPTEFYCHFKNAVTVLRQFGMEDGDFGHNILMILIQIAIFKVLSYFTLKHKIKTN
Estimated Isoelectric Point:
8.06581878662109
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr49
Lys35
Gln27
Leu70
Gly43
Met23
Ser41
Tyr28
His12
Glu30
Arg23
Cys14
Phe32
Pro24
Val35
Asn27
Ala32
Ile49
Trp5
Asp25