Sequence:
download
FLYBASE:CG31298sequence.fasta
>beat-Vb-PB MDLGRWLLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSPLTPPTYIPF AVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFNDFVE VNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETTIVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLG LELRCVAEIDRYPHLQREGTMFAQLFRDDIDQKNQKLINSRSGATPNSQVQHLLLVAISMTMTAVRLFTPLTFQYGARKS ARYKMAAT
view sequence (328 aa)
>beat-Vb-PB
MDLGRWLLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSPLTPPTYIPF
AVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFNDFVE
VNCSTDFSSLFTRITWYVNGIKVSLVDLLPSFETTIVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLG
LELRCVAEIDRYPHLQREGTMFAQLFRDDIDQKNQKLINSRSGATPNSQVQHLLLVAISMTMTAVRLFTPLTFQYGARKS
ARYKMAAT
Estimated Isoelectric Point:
8.92725372314453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys11
Gln19
Leu36
Gly15
Met8
Ser26
Tyr12
His8
Glu13
Arg24
Cys7
Phe17
Pro14
Val26
Asn18
Ala17
Ile17
Trp3
Asp16