Sequence:
download
FLYBASE:CG31175sequence.fasta
>Dys-PH MEPGILIDERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQTNLKPEKGRMRVHHINNLNKVITE IQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQHLVKSHSSNGVEKSLLAWARQYTEPHGLQLNDFSSSWSDGRA FLMILDAHVEELNLQAALQQHALKRLHLAFDLAHRHFKIEKLLDAEDVHTHKPDNKSIQMYVMCLYHAMESMRTRQQEQE QDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLYTSDSAGSMEQRSSGELKTHSMRPLSTATNASVEISGYQSALEAVL TLLLEDEQLLSQNLPDPQDFQTAKLQFHENESFMLKLTEHQEYVGEALEEGSNLINESQKAGAGLSQEDQNEVRQQMVLL NERWETLRLRALDVQAKILMRLAEFQKQKLEQLRQFLTSVEDRISHMSDIGPTLEEAEKQLLEAQKLKADLSEQQELVDS LSSMVVIVNDTSGNFNDLEDRLSALGERWSHVVKWSDLRKEKLQQYKCISRWLDAREQDLKLMESRDVTDVGGITQRINE LNYCAKDLLELQRYLIDLRQMVAATLQDGDDKGERVLIQLESYEDRLDALKQIVEVQTVRIETKGFNFGRDRASYDDSRV VRPEGWVDYQMIIRFGEDDSQEDDDEHDLASKKRKLRNADNFNALENHIMEHFGYVQEVEQKLQQLQRQSLRQQCELLKE LQAENSRRCGTLPELKKLYEVCELEDPSRNLLLEETHIKQLEQRYANLSQKLSSQQSESHTLLAKEKYYNSLTGFKLVLA DSRDWYKQHAGSASGNELEQRLSHMESLASEISEAKTATEELDDNLIEWKQDFGLFYDSWHDMKQALQALIQQRGGESLS RQLKQIQDFVTKVSNQKVRVSNLEVMQEQQHFLNQLLDEMESLRLTYDNIPKHLIGEELQTAWNRLPEQLNERVIKQTTA IENLNHFAAEYNAIIAMLRSAADSKLNGSDGASSQDLRKLEIDVISARNFSEILIKEAEPAQKESLQSQIRALNTLYDQV EQVHREKKEQQTVLQSHIDLIQLRLKETDQWLTDLESNTPKSGISDIVNSNELFQSKSRFQTLKETCERETTQFRDLNER GGELLLQMDELQDQDRESRYGSLAKQFTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTP ENAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQRWTQLQQQAKKRTELLEQKVSEA EQSEKCIVQFEKWLTRVDDILSDHLDNDVTIVDQPEEFQRLAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNL MEVRFKYCQAKLSKCTAIQHSYESRLNRAYTDLRNVERSTEVVDVASAGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKT GRRVCEDRYTKSPKQLSQRIDALKHLYNTLGENVTQSKATLERLLTLARQLEECFDSADNLIRRFESPQEVHDRNSILLE FEDVLRRCEDHYNEYNKSCDQSCMVETRQRIDGLKATYHKLTSADIIKRLTEMKTTLQNLDNISLETLRAMEHDLKEINV PSNPEIEKLQQQVIAIVVDVLKTRFNEATTLAARNTSSPDNDDTEIVVVSDTVRQRRARTPQSGESPSSAHTSSSESPTK GVENSPGAVGDQVMPDLLPPQTFRLAESSTLFSQISLNPQKVTNTPPPKPAKTKRKAPSSPAQVVEIRVKNIQNDKMSVQ NIDLEPQQGEIVDTVNILESVEPFVPEYVETVQIVDLSEDSDSSVRVDSQGKEMRRSKSKHSLNETPLPKVSDNDEDSAE QEEDLLRPSAENTSTPFLRVEKRRISFDEKRKRVANERDILRDSEEEEPKTPDTPRAAQVSKPKRWRQLQPEMDALEPES PGRDSFYSPDKESGFDAEPLVFSDDEDIPRFSLEMTSTIDSDSDTSRIMTPSTKNPNPFLSKVLESLSSPVDDSNVTLKS PISEEQPQNLDDRVREFDKQAKQMIYKLKLTKAKIEQCHESEAEDLRLLIAPDAATLISQGDSLVLETHGRQGSISRLVM RTQIILREQFREVQQARSKTSGSGAPAPPLDSVNIEELVTKGLRRINVLIEKTVDLKSSTDLEKRMEDINERHDDLQVIV SAIGKNAQMPKVTPLMMNEIEKTKNNLIAHADSIELSLTELRNGPRISNGKERPDASSAATMSCRSEYNNEPSGTGALAG SFDKSVLQISDWLTWEQNMIKIQSVLVDDGDAVRLAIEKQEKVLRELKMKKPQLNELVHTAEVLKGDVKRQQLQEKELKQ FSLAPHCSADLDYMRCCLKVTRLREHWDETSQCVLQRAAQLKNMLSDSQRFEAKRLELEKWLARMEQRAERMGTIATTAD ILEAQQKEQKSFHAELHQNKQHFDIFNELTQKLIAVYPNDDTTRIKKMTEVINQRYANLNSGVINRGKQLHAAVHSLQSF DRAMDQFLAFLSETETLCENAESDIERNPLMFKDLQSEIETHRVVYDRLDGTGRKLLGSLTSQEDAVMLQRRLDEMNQRW NNLKSKSIAIRNRLESNSEHWNALLLSLRELTEWVIRKDTELSTLGLGPVRGDAVSLQKQLDDHKAFRRQLEDKRPIVES NLTSGRQYIANEAAVSDTSDTEANHDSDSRYMSAEEQSRELTRSIRREVGKLSEQWNNLIDRSDNWKHRLDEYMTKMRQF QKILEDLSSRVALAEQTKTSWLPPSSVGEANEQMQQLQRLRDKMTTASALLDDCNEQQSFFTANQVLVPTPCLSKLEDLN TRMKLLQIAMDERQKVLCQAGAQQTHENGDDGRTTSNSGTIGPLPNLGQSVKPPWERATTAANVPYYIDHERETTHWDHP EMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLHSLYVTIDKID LTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGE VAAFGGSNIEPSVRSCLEQAGISQEAIDGNQDISIELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPI VGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVL EGDALESPAPSPQHTTHQLQNDMHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVM AAMDAEQREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQGEQGQDMMAEAKLLRQHKGR LEARMQILEDHNRQLEAQLQRLRQLLDEPNGGGSSATSSGLPSAPGSALNSKPNTLQTRSVTASQLNTDSPAKMNQQNGH YEHNSKGIMLPGMNSEIQQQHAQLASLAAKHHQHQLSGALNALHQQQQQQLQQQPPQQQRSMMTGNGGMDISGGMQTSGG YLGDDGRPPPPPHSSLMQQQHQQHLNENSSGLVTVITEQELESINDDLEDSSSSNTTNTTTTTTTTATTEKTCVELQK
view sequence (3598 aa)
>Dys-PH
MEPGILIDERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQTNLKPEKGRMRVHHINNLNKVITE
IQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQHLVKSHSSNGVEKSLLAWARQYTEPHGLQLNDFSSSWSDGRA
FLMILDAHVEELNLQAALQQHALKRLHLAFDLAHRHFKIEKLLDAEDVHTHKPDNKSIQMYVMCLYHAMESMRTRQQEQE
QDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLYTSDSAGSMEQRSSGELKTHSMRPLSTATNASVEISGYQSALEAVL
TLLLEDEQLLSQNLPDPQDFQTAKLQFHENESFMLKLTEHQEYVGEALEEGSNLINESQKAGAGLSQEDQNEVRQQMVLL
NERWETLRLRALDVQAKILMRLAEFQKQKLEQLRQFLTSVEDRISHMSDIGPTLEEAEKQLLEAQKLKADLSEQQELVDS
LSSMVVIVNDTSGNFNDLEDRLSALGERWSHVVKWSDLRKEKLQQYKCISRWLDAREQDLKLMESRDVTDVGGITQRINE
LNYCAKDLLELQRYLIDLRQMVAATLQDGDDKGERVLIQLESYEDRLDALKQIVEVQTVRIETKGFNFGRDRASYDDSRV
VRPEGWVDYQMIIRFGEDDSQEDDDEHDLASKKRKLRNADNFNALENHIMEHFGYVQEVEQKLQQLQRQSLRQQCELLKE
LQAENSRRCGTLPELKKLYEVCELEDPSRNLLLEETHIKQLEQRYANLSQKLSSQQSESHTLLAKEKYYNSLTGFKLVLA
DSRDWYKQHAGSASGNELEQRLSHMESLASEISEAKTATEELDDNLIEWKQDFGLFYDSWHDMKQALQALIQQRGGESLS
RQLKQIQDFVTKVSNQKVRVSNLEVMQEQQHFLNQLLDEMESLRLTYDNIPKHLIGEELQTAWNRLPEQLNERVIKQTTA
IENLNHFAAEYNAIIAMLRSAADSKLNGSDGASSQDLRKLEIDVISARNFSEILIKEAEPAQKESLQSQIRALNTLYDQV
EQVHREKKEQQTVLQSHIDLIQLRLKETDQWLTDLESNTPKSGISDIVNSNELFQSKSRFQTLKETCERETTQFRDLNER
GGELLLQMDELQDQDRESRYGSLAKQFTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTP
ENAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQRWTQLQQQAKKRTELLEQKVSEA
EQSEKCIVQFEKWLTRVDDILSDHLDNDVTIVDQPEEFQRLAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNL
MEVRFKYCQAKLSKCTAIQHSYESRLNRAYTDLRNVERSTEVVDVASAGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKT
GRRVCEDRYTKSPKQLSQRIDALKHLYNTLGENVTQSKATLERLLTLARQLEECFDSADNLIRRFESPQEVHDRNSILLE
FEDVLRRCEDHYNEYNKSCDQSCMVETRQRIDGLKATYHKLTSADIIKRLTEMKTTLQNLDNISLETLRAMEHDLKEINV
PSNPEIEKLQQQVIAIVVDVLKTRFNEATTLAARNTSSPDNDDTEIVVVSDTVRQRRARTPQSGESPSSAHTSSSESPTK
GVENSPGAVGDQVMPDLLPPQTFRLAESSTLFSQISLNPQKVTNTPPPKPAKTKRKAPSSPAQVVEIRVKNIQNDKMSVQ
NIDLEPQQGEIVDTVNILESVEPFVPEYVETVQIVDLSEDSDSSVRVDSQGKEMRRSKSKHSLNETPLPKVSDNDEDSAE
QEEDLLRPSAENTSTPFLRVEKRRISFDEKRKRVANERDILRDSEEEEPKTPDTPRAAQVSKPKRWRQLQPEMDALEPES
PGRDSFYSPDKESGFDAEPLVFSDDEDIPRFSLEMTSTIDSDSDTSRIMTPSTKNPNPFLSKVLESLSSPVDDSNVTLKS
PISEEQPQNLDDRVREFDKQAKQMIYKLKLTKAKIEQCHESEAEDLRLLIAPDAATLISQGDSLVLETHGRQGSISRLVM
RTQIILREQFREVQQARSKTSGSGAPAPPLDSVNIEELVTKGLRRINVLIEKTVDLKSSTDLEKRMEDINERHDDLQVIV
SAIGKNAQMPKVTPLMMNEIEKTKNNLIAHADSIELSLTELRNGPRISNGKERPDASSAATMSCRSEYNNEPSGTGALAG
SFDKSVLQISDWLTWEQNMIKIQSVLVDDGDAVRLAIEKQEKVLRELKMKKPQLNELVHTAEVLKGDVKRQQLQEKELKQ
FSLAPHCSADLDYMRCCLKVTRLREHWDETSQCVLQRAAQLKNMLSDSQRFEAKRLELEKWLARMEQRAERMGTIATTAD
ILEAQQKEQKSFHAELHQNKQHFDIFNELTQKLIAVYPNDDTTRIKKMTEVINQRYANLNSGVINRGKQLHAAVHSLQSF
DRAMDQFLAFLSETETLCENAESDIERNPLMFKDLQSEIETHRVVYDRLDGTGRKLLGSLTSQEDAVMLQRRLDEMNQRW
NNLKSKSIAIRNRLESNSEHWNALLLSLRELTEWVIRKDTELSTLGLGPVRGDAVSLQKQLDDHKAFRRQLEDKRPIVES
NLTSGRQYIANEAAVSDTSDTEANHDSDSRYMSAEEQSRELTRSIRREVGKLSEQWNNLIDRSDNWKHRLDEYMTKMRQF
QKILEDLSSRVALAEQTKTSWLPPSSVGEANEQMQQLQRLRDKMTTASALLDDCNEQQSFFTANQVLVPTPCLSKLEDLN
TRMKLLQIAMDERQKVLCQAGAQQTHENGDDGRTTSNSGTIGPLPNLGQSVKPPWERATTAANVPYYIDHERETTHWDHP
EMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLHSLYVTIDKID
LTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGE
VAAFGGSNIEPSVRSCLEQAGISQEAIDGNQDISIELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPI
VGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVL
EGDALESPAPSPQHTTHQLQNDMHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVM
AAMDAEQREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQGEQGQDMMAEAKLLRQHKGR
LEARMQILEDHNRQLEAQLQRLRQLLDEPNGGGSSATSSGLPSAPGSALNSKPNTLQTRSVTASQLNTDSPAKMNQQNGH
YEHNSKGIMLPGMNSEIQQQHAQLASLAAKHHQHQLSGALNALHQQQQQQLQQQPPQQQRSMMTGNGGMDISGGMQTSGG
YLGDDGRPPPPPHSSLMQQQHQQHLNENSSGLVTVITEQELESINDDLEDSSSSNTTNTTTTTTTTATTEKTCVELQK
Estimated Isoelectric Point:
5.31093597412109
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr206
Lys208
Gln284
Leu407
Gly143
Met88
Ser298
Tyr64
His98
Glu329
Arg228
Cys42
Phe82
Pro119
Val174
Asn172
Ala218
Ile164
Trp34
Asp240