Sequence:
download
FLYBASE:CG3019sequence.fasta
>su(w[a])-PA MLPYNVRNAGGGSVGGILRRTGQGSGTGSTILGNGNSPGALGAGKVSSSLENHRQPPLELLVFGYACKIFRDDEKAREMD HGKQLIPWMGDVNLKIDRYDVRGALCELAPHEAPPGGYGNRLEYLSAEEQRAEQLCEEERYLFLYNNEEELRLRQEEDLK RLQQETSGGCFSQVGFQYDGQSAASTSIGGSSTATSQLSPNSEESELPFVLPYTLMMAPPLDMQLPETMKQHAIIEKTAR FIATQGAQMEILIKAKQANNTQFDFLTQGGHLQPYYRHLLAAIKAAKFPPAPQTPLDQQNTDKEAPSADDHSEEVAGGRR NPNQVVITVPTIKYKPSANCAYTQLISKIKGVPLQAVLQEDESSNPGNSQHSGGTASPALSCRSEGHNSQGGEFTPVLLQ YNGSTFTHEEESSNREQQDDNDVNGGEPPQVELLKNTSALALAQNYSSESEEEEDQVQPEKEEEKKPEPVLTFPVPKDSL RHIIDKTATYVIKNGRQFEETLRTKSVDRFSFLLPANEYYPYYLYKVTGDVDAASKEEKTRKAAAVAAALMSKKGLSFGG AAAAVSGSNLDKAPVSFSIRARDDQCPLQHTLPQEASDEETSSNAAGVEHVRPGMPDSVQRAIKQVETQLLARTAGQKGN ITASPSCSSPQKEQRQAEERVKDKLAQIAREKLNGMISREKQLQLERKRKALAFLNQIKGEGAIVGSAVPVVGPNPPESA AGAATADSGDESGDSVRSIPITYFGPDDDDEVGEQRPEMRLIGSTQKDEEDDDEEDGGDLEKYNLLNDDSTNTFTSKPVL PPTAAPPPAAVLLSDDDDVQLVATTSTRSSSSRHLKTHRRSRSRSKNVRSSDSSPSSRESSRRRRQKSSRLSREPSSNPP RKSQHSSTQRKKTPKKRRRSKSRSRSKSIRRSRSISILRNNRRSRSRSPSCRNAEQRRQQDRRRTPTKKSHKRHKRRRRS SSP
view sequence (963 aa)
>su(w[a])-PA
MLPYNVRNAGGGSVGGILRRTGQGSGTGSTILGNGNSPGALGAGKVSSSLENHRQPPLELLVFGYACKIFRDDEKAREMD
HGKQLIPWMGDVNLKIDRYDVRGALCELAPHEAPPGGYGNRLEYLSAEEQRAEQLCEEERYLFLYNNEEELRLRQEEDLK
RLQQETSGGCFSQVGFQYDGQSAASTSIGGSSTATSQLSPNSEESELPFVLPYTLMMAPPLDMQLPETMKQHAIIEKTAR
FIATQGAQMEILIKAKQANNTQFDFLTQGGHLQPYYRHLLAAIKAAKFPPAPQTPLDQQNTDKEAPSADDHSEEVAGGRR
NPNQVVITVPTIKYKPSANCAYTQLISKIKGVPLQAVLQEDESSNPGNSQHSGGTASPALSCRSEGHNSQGGEFTPVLLQ
YNGSTFTHEEESSNREQQDDNDVNGGEPPQVELLKNTSALALAQNYSSESEEEEDQVQPEKEEEKKPEPVLTFPVPKDSL
RHIIDKTATYVIKNGRQFEETLRTKSVDRFSFLLPANEYYPYYLYKVTGDVDAASKEEKTRKAAAVAAALMSKKGLSFGG
AAAAVSGSNLDKAPVSFSIRARDDQCPLQHTLPQEASDEETSSNAAGVEHVRPGMPDSVQRAIKQVETQLLARTAGQKGN
ITASPSCSSPQKEQRQAEERVKDKLAQIAREKLNGMISREKQLQLERKRKALAFLNQIKGEGAIVGSAVPVVGPNPPESA
AGAATADSGDESGDSVRSIPITYFGPDDDDEVGEQRPEMRLIGSTQKDEEDDDEEDGGDLEKYNLLNDDSTNTFTSKPVL
PPTAAPPPAAVLLSDDDDVQLVATTSTRSSSSRHLKTHRRSRSRSKNVRSSDSSPSSRESSRRRRQKSSRLSREPSSNPP
RKSQHSSTQRKKTPKKRRRSKSRSRSKSIRRSRSISILRNNRRSRSRSPSCRNAEQRRQQDRRRTPTKKSHKRHKRRRRS
SSP
Estimated Isoelectric Point:
8.77718353271484
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys59
Gln60
Leu73
Gly65
Met12
Ser107
Tyr23
His18
Glu78
Arg79
Cys9
Phe21
Pro64
Val43
Asn41
Ala77
Ile32
Trp1
Asp51