Sequence:
download
FLYBASE:CG2708sequence.fasta
>unc-45-PB MTNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAA PGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERSARNAKTSTKVKQMMDLTFDLATPID KRRAAANNLVVLAKEQTGAELLYKDHCIAKVASLTKVEKDQDIYVNMVHLVAALCENSVERTKGVLTELGVPWFMRVLDQ KHENCVSTAQFCLQTILNALSGLKNKPDSKPEKELCTRNNREIDTLLTCLVYSITDRTISGAARDGVIELITRNVHYTAL EWAERLVEIRGLCRLLDVCSELEDYKYESAMDITGSSSTIASVCLARIYENMYYDEAKARFTDQIDEYIKDKLLAPDMES KVRVTVAITALLNGPLDVGNQVVAREGILQMILAMATTDDELQQRVSCECLIAASSKKDKAKALCEQGVDILKRLYHSKN DGIRVRALVGLCKLGSYGGQDAAIRPFGDGAALKLAEACRRFLIKPGKDKDIRRWAADGLAYLTLDAECKEKLIEDKASI HALMDLARGGNQSCLYGVVTTFVNLCNAYEKQEMLPEMIELAKFAKQHIPEEHELDDVDFINKRITVLANEGITTALCAL AKTESHNSQELIARVLNAVCGLKELRGKVVQEGGVKALLRMALEGTEKGKRHATQALARIGITINPEVSFSGQRSLDVIR PLLNLLQQDCTALENFESLMALTNLASMNESVRQRIIKEQGVSKIEYYLMEDHLYLTRAAAQCLCNLVMSEDVIKMFEGN NDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEIA KKLFETDIMELLSGLGQLPDDTRAKAREVATQCLAAAERYRIIERSDNAEIPDVFAENSKISEIIDD
view sequence (947 aa)
>unc-45-PB
MTNTINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVEDCTESLKAA
PGDPKALFRRAQAYEALEKFEEAYKDATALFKADPGNKTVQPMLQRLHVVVEERSARNAKTSTKVKQMMDLTFDLATPID
KRRAAANNLVVLAKEQTGAELLYKDHCIAKVASLTKVEKDQDIYVNMVHLVAALCENSVERTKGVLTELGVPWFMRVLDQ
KHENCVSTAQFCLQTILNALSGLKNKPDSKPEKELCTRNNREIDTLLTCLVYSITDRTISGAARDGVIELITRNVHYTAL
EWAERLVEIRGLCRLLDVCSELEDYKYESAMDITGSSSTIASVCLARIYENMYYDEAKARFTDQIDEYIKDKLLAPDMES
KVRVTVAITALLNGPLDVGNQVVAREGILQMILAMATTDDELQQRVSCECLIAASSKKDKAKALCEQGVDILKRLYHSKN
DGIRVRALVGLCKLGSYGGQDAAIRPFGDGAALKLAEACRRFLIKPGKDKDIRRWAADGLAYLTLDAECKEKLIEDKASI
HALMDLARGGNQSCLYGVVTTFVNLCNAYEKQEMLPEMIELAKFAKQHIPEEHELDDVDFINKRITVLANEGITTALCAL
AKTESHNSQELIARVLNAVCGLKELRGKVVQEGGVKALLRMALEGTEKGKRHATQALARIGITINPEVSFSGQRSLDVIR
PLLNLLQQDCTALENFESLMALTNLASMNESVRQRIIKEQGVSKIEYYLMEDHLYLTRAAAQCLCNLVMSEDVIKMFEGN
NDRVKFLALLCEDEDEETATACAGALAIITSVSVKCCEKILAIASWLDILHTLIANPSPAVQHRGIVIILNMINAGEEIA
KKLFETDIMELLSGLGQLPDDTRAKAREVATQCLAAAERYRIIERSDNAEIPDVFAENSKISEIIDD
Estimated Isoelectric Point:
5.57006072998047
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr49
Lys70
Gln31
Leu106
Gly47
Met22
Ser47
Tyr26
His16
Glu83
Arg51
Cys28
Phe20
Pro20
Val60
Asn41
Ala108
Ile60
Trp5
Asp57