Sequence:
download
FLYBASE:CG17383sequence.fasta
>jigr1-PH MENLSHLYPPQLPKGRGRPRATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMT TLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDS EIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLD DHPSKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGSKEKTD EVDPVDQSSESQEEDE
view sequence (336 aa)
>jigr1-PH
MENLSHLYPPQLPKGRGRPRATYAQTGEFDLGLIREYRSHPVLYDRSNKRFKDKLYVAHIWEQIAHKLGYDATSIRERMT
TLRNRYNIEKRRVENGLSTQSSQWPLFESLQFLGDHIRPRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDS
EIFDCEQALPVTTVLGIPLNNSDEANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLD
DHPSKRRVDDSLSISGYYPTQPLAPLPPAYAKFRGFGEFMCHSLCDMPAATALRLVQKFTRELVQSSLRNEDSGSKEKTD
EVDPVDQSSESQEEDE
Estimated Isoelectric Point:
5.78763580322266
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys17
Gln16
Leu26
Gly17
Met8
Ser34
Tyr14
His12
Glu30
Arg28
Cys4
Phe11
Pro21
Val13
Asn18
Ala14
Ile13
Trp2
Asp24