Sequence:
download
FLYBASE:CG15445sequence.fasta
>CG15445-PH MSQNDNLLIQIRALLQSDGEKLWEEPYYSEDLGSIEGALENLAQKYSGMLGIDIGRCKFFLTELQENALRTLAARREFST TGIATLKVRRVGEHSGATMVEVKCSLDIVGSELQACIAKKLEVPNAAHVKCIAAGKVVSANATLADQQLKNNQQLIVIVG DGDNSGEALYERINRIKADVEAVVSSKNNLIEMEDQNGSQVYLPPSEHKALLMGLGFCEKARAAMNRKHFEEALLLLLEA DEHFSTCGSKFLESVDNYALLNLDIVWCYFCLKNVTQLPDAEHRLARCSRNFGISYGDNLERLYSLKGKDCPERALIMRL KLLQGVIFFHQNLRNQAFECFEAAKTLLNELKINNDQLALLVDMGFEPSEARMALRSCKGGTAVEQAVQFIHERRQQLKN ARMKYKASERAMERRLKRSNSKDCTWVNPRSVCSLADMGFESGLATIALQRSNNDILQAVELLQTESDELTGASPWFPVT VDTTKLAQLLQLGFNENDSRVALQNASNNMEEAIESLMCAIESEEELKAILKHVGRLAENGGQNLDGPSTSNASGQTQVA LPAPIIEAVINHARVEIETYKAYERFNSDLKLSDLEYLDLPLIQEEKILTEYFNMLQQ
view sequence (618 aa)
>CG15445-PH
MSQNDNLLIQIRALLQSDGEKLWEEPYYSEDLGSIEGALENLAQKYSGMLGIDIGRCKFFLTELQENALRTLAARREFST
TGIATLKVRRVGEHSGATMVEVKCSLDIVGSELQACIAKKLEVPNAAHVKCIAAGKVVSANATLADQQLKNNQQLIVIVG
DGDNSGEALYERINRIKADVEAVVSSKNNLIEMEDQNGSQVYLPPSEHKALLMGLGFCEKARAAMNRKHFEEALLLLLEA
DEHFSTCGSKFLESVDNYALLNLDIVWCYFCLKNVTQLPDAEHRLARCSRNFGISYGDNLERLYSLKGKDCPERALIMRL
KLLQGVIFFHQNLRNQAFECFEAAKTLLNELKINNDQLALLVDMGFEPSEARMALRSCKGGTAVEQAVQFIHERRQQLKN
ARMKYKASERAMERRLKRSNSKDCTWVNPRSVCSLADMGFESGLATIALQRSNNDILQAVELLQTESDELTGASPWFPVT
VDTTKLAQLLQLGFNENDSRVALQNASNNMEEAIESLMCAIESEEELKAILKHVGRLAENGGQNLDGPSTSNASGQTQVA
LPAPIIEAVINHARVEIETYKAYERFNSDLKLSDLEYLDLPLIQEEKILTEYFNMLQQ
Estimated Isoelectric Point:
5.20786285400391
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr22
Lys34
Gln33
Leu81
Gly34
Met15
Ser41
Tyr14
His10
Glu58
Arg33
Cys15
Phe20
Pro14
Val32
Asn40
Ala59
Ile31
Trp4
Asp28