Sequence:
download
FLYBASE:CG1501sequence.fasta
>unc-PB MKVRHVPASTTTLSFRAKQRDVGGIGMPCERERKHEAAKREREEQIKQERATAASATQRVRQHNRRISTDGDPARRRMTQ SRERLQATGLGRPGPCGPSNITRVTRGSSLPPEVGAHGYRTGRPTRKHVPIPQDQIEEQDDSDARAERLRQQLEELAAMS EQEFEVKFRQWLDQEGIAREMHSHLRVELIHCFNNTALGQLLSKAAGVQMAQSHALLVSPLAMVLHTLVAEFLHSQNCHF TLSVFCSETPHRSNLPDFRSRPEFRFQTEELQKVVAAILGEKEALADSEFGKLAEAHYEEDLAGQTQCLLMALMRTLVEI RRSVPKQEVEQPVPVSLQDTGCQTEPSACVEARPEVDTTGLYQTEEHELILGADGRSVFVGGRVSQSLHSVEQQLNQLIK NLRHLAKSCAPPVEVISSTKFEDLLMKELRERERLLKAGQAFNPGEPVIKIATGDKEEEHEVTSGRNQKDVVHSNLGPIQ VPALDVTIPQLPRLHSEQLASLAVIRQSLEKVQKKSRQPQGRMYVSMERMETLMGDVCGCVQLLSNVLNLSMEQEHSVGM HKGFKWGYREGFAHGHFMGLQEGQKLEQLEQKKWQKERPLPEKRESSVQTESTIPTASIATQTSRKSAHNESVITQTEQK QLKDAGNQASCEPPTFQKSYEQWIHEMLHSSSGQVFLERVELSLNKALELQKVRLNELFQVKLRHQAEMLRLSKRQNSWR TLCKRVERDSQSSAEARDLVQQIFRLLEHYEAHHQQLAEKIQQTELAAEQAARIMPMWADGAAVGSASVNWNTAMSTTLI SSGICTPPPAQPAADGALNVGKTHVEQHTYPDLGYPYQLLALAPPGGVPVAGTFVPVTHLPAHLLGASEHPVPLVPVARI YSDPMKTSRRLLSPSSVPADNDSAHRAAGETNAFTFQGGPVSGDLHPTENRNQAPATQGQQFPVPLPVPAPRGPSPSVQS VLPSTASPALPPPDETVPQPGPSQSSIPLKPSMHSVATNTITPVPPKATPLKPVNSKVSEGPSFEEALLSAKSRMLQLEQ ESDLLEQSFLSYLEKTKSKTSPHKSSEDAARARRIRSSCLREREQVHRTMDGFRDWHRRVRKEDAASVAQLEELRNQRLI PDPILDSKGSSPLWLSELEEGHEQDSYPFTNAITEARNKVLDKIMPVRKEEKKEKQNVKKNWLADLPFQIPEASPKQDRH LTNVKPAVTRSSSNGEMNVLLQRAKDALGLRTPNPLLDSSSSSSSMELPSMGAGRSPSTKFQQSMARMQMLFGGAEAVKP TMPAKTGRPVSAPTAASEPGLCAHLVLPKRPHTAPTLHTINENEPAVHHLDVSTSSSSQSTLPGRSSGEAFEDLVMSAVA DGARRRNAESSTEVSYSQAFWKRINL
view sequence (1386 aa)
>unc-PB
MKVRHVPASTTTLSFRAKQRDVGGIGMPCERERKHEAAKREREEQIKQERATAASATQRVRQHNRRISTDGDPARRRMTQ
SRERLQATGLGRPGPCGPSNITRVTRGSSLPPEVGAHGYRTGRPTRKHVPIPQDQIEEQDDSDARAERLRQQLEELAAMS
EQEFEVKFRQWLDQEGIAREMHSHLRVELIHCFNNTALGQLLSKAAGVQMAQSHALLVSPLAMVLHTLVAEFLHSQNCHF
TLSVFCSETPHRSNLPDFRSRPEFRFQTEELQKVVAAILGEKEALADSEFGKLAEAHYEEDLAGQTQCLLMALMRTLVEI
RRSVPKQEVEQPVPVSLQDTGCQTEPSACVEARPEVDTTGLYQTEEHELILGADGRSVFVGGRVSQSLHSVEQQLNQLIK
NLRHLAKSCAPPVEVISSTKFEDLLMKELRERERLLKAGQAFNPGEPVIKIATGDKEEEHEVTSGRNQKDVVHSNLGPIQ
VPALDVTIPQLPRLHSEQLASLAVIRQSLEKVQKKSRQPQGRMYVSMERMETLMGDVCGCVQLLSNVLNLSMEQEHSVGM
HKGFKWGYREGFAHGHFMGLQEGQKLEQLEQKKWQKERPLPEKRESSVQTESTIPTASIATQTSRKSAHNESVITQTEQK
QLKDAGNQASCEPPTFQKSYEQWIHEMLHSSSGQVFLERVELSLNKALELQKVRLNELFQVKLRHQAEMLRLSKRQNSWR
TLCKRVERDSQSSAEARDLVQQIFRLLEHYEAHHQQLAEKIQQTELAAEQAARIMPMWADGAAVGSASVNWNTAMSTTLI
SSGICTPPPAQPAADGALNVGKTHVEQHTYPDLGYPYQLLALAPPGGVPVAGTFVPVTHLPAHLLGASEHPVPLVPVARI
YSDPMKTSRRLLSPSSVPADNDSAHRAAGETNAFTFQGGPVSGDLHPTENRNQAPATQGQQFPVPLPVPAPRGPSPSVQS
VLPSTASPALPPPDETVPQPGPSQSSIPLKPSMHSVATNTITPVPPKATPLKPVNSKVSEGPSFEEALLSAKSRMLQLEQ
ESDLLEQSFLSYLEKTKSKTSPHKSSEDAARARRIRSSCLREREQVHRTMDGFRDWHRRVRKEDAASVAQLEELRNQRLI
PDPILDSKGSSPLWLSELEEGHEQDSYPFTNAITEARNKVLDKIMPVRKEEKKEKQNVKKNWLADLPFQIPEASPKQDRH
LTNVKPAVTRSSSNGEMNVLLQRAKDALGLRTPNPLLDSSSSSSSMELPSMGAGRSPSTKFQQSMARMQMLFGGAEAVKP
TMPAKTGRPVSAPTAASEPGLCAHLVLPKRPHTAPTLHTINENEPAVHHLDVSTSSSSQSTLPGRSSGEAFEDLVMSAVA
DGARRRNAESSTEVSYSQAFWKRINL
Estimated Isoelectric Point:
8.04755401611328
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr76
Lys69
Gln96
Leu132
Gly73
Met35
Ser131
Tyr14
His49
Glu119
Arg99
Cys16
Phe34
Pro102
Val89
Asn40
Ala117
Ile38
Trp11
Asp46