Sequence:
download
FLYBASE:CG13363sequence.fasta
>Hmt4-20-PB MVVGSNHTRRGETGSRFTNSSSSSSTSGGPTASASSTTSVTSSLATNSTSTSTAAALLSSMSHKSHGPPPSAPPSAHHQT NQQHHQVAHSQPHATHYQQTNQHPSHHHQSHQSSNGSGGGSAGSGSGSGSVVSGLNGCNGSAVSRLSQSTGMSPRELSEN DDLATSLILDPHLGFQTHKMNIRFRPLKVDTQQLKAIVDDFIHTQNYDIAIQRIYEGPWIPRHLKNKNKIATKRLHDHIV RYLRVFDKDSGFAIEACYRYTLEEQRGAKISSTKRWSKNDKIECLVGCIAELTEAEEAALLHSGKNDFSVMYSCRKNCAQ LWLGPAAYINHDCRANCKFLATGRDTACVKVLRDIEVGEEITCFYGEDFFGDSNRYCECETCERRGTGAFAGKDDGLMLG LSMGLGLASSGPGNNGGYRLRETDNRINRIKSRANSTNSTSNSNSNTNDSTGPSETSSTNGLVASGGAGGATGAAMLPTP SQQSTGGKEATAAVSLLEKKLPNVVVSPLTMKELRQKGMTKYDAEMIMANAAYQQQHHHQHHFHHHHHHHHHHHNHGQHA STGAEATAAVQQMAAMQKPGVGGTGAAGNAGATTVSSVAAGAGSEVNGGRSTSLRKSMRVNSTSSSISTASADEVIAPVV AASISLPSKAPVVLMPRCKPAQMAIAALHQSQQRQLRRSERQKEKLTDGESSDTSSEQQKKEQKQQDHQLPQKMFSLAEE PQPEKSEEKQQEQQKRVTRNSAGRVGLVARLATAHNNNIATTTNSSSSSNKATTITNCNNHNSNNSSRINHNSNLSSRLS VKSRKPAPSEASSIPSSTSSENQQQQATRRSCSPTPAYKKNLLASFDPDPPSTQGIKEQLKDESVTYSPVKQKRSRRAAA LAAAQSIHCEALGGFPTGSTGSQRKRAQAGEPTTSCSSTTISNVEPLLKTPERRLKLTLRMKRSPILDEVIELGTSLSNG GAGRGAPGSHREGTAGEGSVRSALNLTGSSSNGIEYEILRMEGISEHGNDDDEDEEEDDEEPAAEEEEEPPPKEELQLVN KKQRKKQRSRSRSSQRRSPAPSSVYGTPQKKRLRLIFGNESHTIDIPPAAAEGSGSGLDDLNSSGGGGDESFNASYASST SLTVNTSSSSTSSSSGVGGATSTSAEPVDSSTVGPPIAAQSPSSTTSSSFQSACTSTTNSNSYFPNGKQRAAGEDSYAMH YYQLGKFAGTPSPGQGQAIVSSSSGSSGGGGSGAGFLSMPKHTFGTCALLAPTSFACLQNQPQISQQKTSSGGGAGVVPT STSTGAVTSHHHTNNHHGQK
view sequence (1300 aa)
>Hmt4-20-PB
MVVGSNHTRRGETGSRFTNSSSSSSTSGGPTASASSTTSVTSSLATNSTSTSTAAALLSSMSHKSHGPPPSAPPSAHHQT
NQQHHQVAHSQPHATHYQQTNQHPSHHHQSHQSSNGSGGGSAGSGSGSGSVVSGLNGCNGSAVSRLSQSTGMSPRELSEN
DDLATSLILDPHLGFQTHKMNIRFRPLKVDTQQLKAIVDDFIHTQNYDIAIQRIYEGPWIPRHLKNKNKIATKRLHDHIV
RYLRVFDKDSGFAIEACYRYTLEEQRGAKISSTKRWSKNDKIECLVGCIAELTEAEEAALLHSGKNDFSVMYSCRKNCAQ
LWLGPAAYINHDCRANCKFLATGRDTACVKVLRDIEVGEEITCFYGEDFFGDSNRYCECETCERRGTGAFAGKDDGLMLG
LSMGLGLASSGPGNNGGYRLRETDNRINRIKSRANSTNSTSNSNSNTNDSTGPSETSSTNGLVASGGAGGATGAAMLPTP
SQQSTGGKEATAAVSLLEKKLPNVVVSPLTMKELRQKGMTKYDAEMIMANAAYQQQHHHQHHFHHHHHHHHHHHNHGQHA
STGAEATAAVQQMAAMQKPGVGGTGAAGNAGATTVSSVAAGAGSEVNGGRSTSLRKSMRVNSTSSSISTASADEVIAPVV
AASISLPSKAPVVLMPRCKPAQMAIAALHQSQQRQLRRSERQKEKLTDGESSDTSSEQQKKEQKQQDHQLPQKMFSLAEE
PQPEKSEEKQQEQQKRVTRNSAGRVGLVARLATAHNNNIATTTNSSSSSNKATTITNCNNHNSNNSSRINHNSNLSSRLS
VKSRKPAPSEASSIPSSTSSENQQQQATRRSCSPTPAYKKNLLASFDPDPPSTQGIKEQLKDESVTYSPVKQKRSRRAAA
LAAAQSIHCEALGGFPTGSTGSQRKRAQAGEPTTSCSSTTISNVEPLLKTPERRLKLTLRMKRSPILDEVIELGTSLSNG
GAGRGAPGSHREGTAGEGSVRSALNLTGSSSNGIEYEILRMEGISEHGNDDDEDEEEDDEEPAAEEEEEPPPKEELQLVN
KKQRKKQRSRSRSSQRRSPAPSSVYGTPQKKRLRLIFGNESHTIDIPPAAAEGSGSGLDDLNSSGGGGDESFNASYASST
SLTVNTSSSSTSSSSGVGGATSTSAEPVDSSTVGPPIAAQSPSSTTSSSFQSACTSTTNSNSYFPNGKQRAAGEDSYAMH
YYQLGKFAGTPSPGQGQAIVSSSSGSSGGGGSGAGFLSMPKHTFGTCALLAPTSFACLQNQPQISQQKTSSGGGAGVVPT
STSTGAVTSHHHTNNHHGQK
Estimated Isoelectric Point:
8.83838653564453
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr100
Lys63
Gln74
Leu77
Gly117
Met22
Ser194
Tyr22
His57
Glu73
Arg67
Cys21
Phe24
Pro64
Val51
Asn69
Ala118
Ile42
Trp3
Asp42