Sequence:
download
FLYBASE:CG11848sequence.fasta
>Bili-PH MEPNHYYCRSAMQQNPSTSIPQHASNKLNYGMNAGQDYVTCSSGQSQSGYSSKDLVPRSGNSKTLGGNGNMGSPYGGSVC SNSGQCSKNTANAGNYINIMTVPLGTLQYNRKKLSTQDYESHLYYNTTDVKCRDDYYIANNAAAAIPQHQAHQPHQQPHQ HQHPQHQQQHQQHQQHQQHQQHQQHLHQQQQQQANFLHIQQSLQHNHQLSHPEPIHQLPQLQGTVADPPDAFDNCAIFPS AGGSSNGSGRVAATQTHQNPSGVVTCDQQVPVSLGSVNMPVPPIMYTVHRVVTTAQIQTAAGSTFASSASVSSVVSTGQN DGDCLSPAQVSSAMAASGNASCLGGLPDMGANMMSNASALCPLSDLRSPSGVLTNSSYMPQHHKCNNGNDAQSNPAIQKR LMATSSTSNFATAGKAASNLTRALQNVIPTCVYLMSRVAVHMEIEGTAQCPSQVMLAAALGCEELGISNKLLAQSVFGLW MTSALLEMQLKAHHCPYIVRVAWPNLLQKFSNSSPSDRKFDEPMIVLKRNVFFSKRDEEKIKDHRILELLYEEARNNVLT GRYIMEPVHSLMLGGIQARIELGPYNSHTHTIGFFRENQARFLPPHVAKSSTWLWLPISQKNSAEVKLLEQFKRVPQTAT TRKLMRKYLEFCWALPFYGAAYFHGQIEQPVRGIMALVNQKDMEVLVAVNERGVFVIDPYECTLLLGLRYEDLSWDYAKP SASDDPECLTCIFLQFDAVENGIQVSKLMQIFSKQAAMIDALISHFTDQIRNKKQEGNTQEPFHDEPNPIQNNGNGVLCN KLSRLTLATFDEEGGRCIGQMGSLSISY
view sequence (828 aa)
>Bili-PH
MEPNHYYCRSAMQQNPSTSIPQHASNKLNYGMNAGQDYVTCSSGQSQSGYSSKDLVPRSGNSKTLGGNGNMGSPYGGSVC
SNSGQCSKNTANAGNYINIMTVPLGTLQYNRKKLSTQDYESHLYYNTTDVKCRDDYYIANNAAAAIPQHQAHQPHQQPHQ
HQHPQHQQQHQQHQQHQQHQQHQQHLHQQQQQQANFLHIQQSLQHNHQLSHPEPIHQLPQLQGTVADPPDAFDNCAIFPS
AGGSSNGSGRVAATQTHQNPSGVVTCDQQVPVSLGSVNMPVPPIMYTVHRVVTTAQIQTAAGSTFASSASVSSVVSTGQN
DGDCLSPAQVSSAMAASGNASCLGGLPDMGANMMSNASALCPLSDLRSPSGVLTNSSYMPQHHKCNNGNDAQSNPAIQKR
LMATSSTSNFATAGKAASNLTRALQNVIPTCVYLMSRVAVHMEIEGTAQCPSQVMLAAALGCEELGISNKLLAQSVFGLW
MTSALLEMQLKAHHCPYIVRVAWPNLLQKFSNSSPSDRKFDEPMIVLKRNVFFSKRDEEKIKDHRILELLYEEARNNVLT
GRYIMEPVHSLMLGGIQARIELGPYNSHTHTIGFFRENQARFLPPHVAKSSTWLWLPISQKNSAEVKLLEQFKRVPQTAT
TRKLMRKYLEFCWALPFYGAAYFHGQIEQPVRGIMALVNQKDMEVLVAVNERGVFVIDPYECTLLLGLRYEDLSWDYAKP
SASDDPECLTCIFLQFDAVENGIQVSKLMQIFSKQAAMIDALISHFTDQIRNKKQEGNTQEPFHDEPNPIQNNGNGVLCN
KLSRLTLATFDEEGGRCIGQMGSLSISY
Estimated Isoelectric Point:
7.07460784912109
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr40
Lys31
Gln77
Leu68
Gly53
Met27
Ser78
Tyr27
His37
Glu32
Arg29
Cys21
Phe24
Pro47
Val46
Asn54
Ala66
Ile35
Trp6
Asp30