Sequence:
download
FLYBASE:CG11804sequence.fasta
>ced-6-PD MIKSSLKRLKTAPTTTMPYQPANSGGTSGGSKAAAKMAQLKFWNKQNSSKQQQQDKDKDAADGGNNTSGGGTGSNSNGDA KSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGV AIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASD ITLTIGQAFDLAYRKYMDSTEKTNLSKAQQQINHLQQTVNVYKERLREVSAKLPKAELDALLFNLGIKDILEAPTTEPQN GIEVASEALSNGKLDDDKLLIDTNSTTASTHSASPSSFLPIVPPRNNLSSQISIGGKSNSQKMDELLLNSDSDSDFDPRA DETQEIGGTGRSAISNMFGFEPANSFGQHLFSNNNDHKLQNNNSSLLITSNNNSINSSGFSSELNITPPLLAPPPKIAAP RRLNSVTTGNGLNGNTDLFGSDPFELNNGPNIFKQNQLNLDDFSLESLDPLRK
view sequence (533 aa)
>ced-6-PD
MIKSSLKRLKTAPTTTMPYQPANSGGTSGGSKAAAKMAQLKFWNKQNSSKQQQQDKDKDAADGGNNTSGGGTGSNSNGDA
KSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGV
AIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASD
ITLTIGQAFDLAYRKYMDSTEKTNLSKAQQQINHLQQTVNVYKERLREVSAKLPKAELDALLFNLGIKDILEAPTTEPQN
GIEVASEALSNGKLDDDKLLIDTNSTTASTHSASPSSFLPIVPPRNNLSSQISIGGKSNSQKMDELLLNSDSDSDFDPRA
DETQEIGGTGRSAISNMFGFEPANSFGQHLFSNNNDHKLQNNNSSLLITSNNNSINSSGFSSELNITPPLLAPPPKIAAP
RRLNSVTTGNGLNGNTDLFGSDPFELNNGPNIFKQNQLNLDDFSLESLDPLRK
Estimated Isoelectric Point:
7.70938873291016
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys46
Gln30
Leu48
Gly40
Met7
Ser57
Tyr7
His10
Glu27
Arg13
Cys2
Phe24
Pro26
Val16
Asn48
Ala37
Ile29
Trp2
Asp31