Sequence:
download
FLYBASE:CG11591sequence.fasta
>Dpy-30L2-PB MPVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLA TYLLKNKNRCDEVKTEEN
view sequence (98 aa)
>Dpy-30L2-PB
MPVSPGEGEVNGGGDVAKNDSNSQQSVDGIDAFAACQKPRPDTSSMPVRQYLDQTVAPILLHGLQALARDRPSDPISYLA
TYLLKNKNRCDEVKTEEN
Estimated Isoelectric Point:
4.77933502197266
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys5
Gln6
Leu8
Gly7
Met2
Ser8
Tyr3
His1
Glu5
Arg5
Cys2
Phe1
Pro8
Val7
Asn6
Ala8
Ile3
Asp9