Sequence:
download
FLYBASE:CG11427sequence.fasta
>rb-PC MQQNSASNPFAMSTYVERPQMGLDVEFGADPASGAAFFQSDGRKHDDLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDL FPAVVKNVVSKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSA ADLSPYVRKTAAHAIPKLYSLDADQKDELVMVIEKLLSDRTTLVVGSAVMAFDEVCPERVDLIHKNYRKLCNFLLDVDEW GQVIIINMLTRYARTQFVDPNADDEDLVNDGLGETPVSERFYDESSHSSSHSDDGSSDDEKNKSSTNNKNNGGGNGSRTP SSPSNSYHIDVDHRLLLRQTKPLLQSRNASVVMAVAQLYHHVAPKNEVQLIAKALIRLLRSHKEVQSVVLNCIASMSTKR KAIFEPHLKSFFVRTSDPTHIKLLKLDILTNLASAGSISLILREFQTYISSSDRSFVAATIQAIGRCASSIKEVTETCLS GLVHLLSNHDEHVVAESVVVIKRLLQTKAAEHFEIITQMAKLIDYINVPAARAAIIWLIGEYNEKVPLIAPDVLRKMAKS FVDEQDVVKLQVLNLGVKLYLTNPEQTSLLCQYVFTLARYDPNYDVRDRARFLRQIIFPASGTSSVLSQHARQVFLASKP APVPESKYRDGNNFQLGSLSHYLNMPAAGYKELPAFPVIPPDSSVRNIAGFMQDKLPGEDSPSGHSKDKSGREGGKEKGA GGEKGFLSESDDKSSAYSESGSSSGSGTSDSESDSDGSGSSDEEEEEVQKQQPTKVSSVKERLIDAGSNELAATSSPVKA TINNNNNARGSSGTSDSEDSSAYSGSSSDDSASGSDNEVKKNETKTDTGTKPEKLKEKHEKQPEQTAVKSNLDLLLDLDD IPPIGPVMTPSLGGFLTPGTPMMAGQAAPLQPQHARNRVELVGPSHIEFKHKELLNKVSGHGLHLAYRFTRSPHLYSSSM CSIELQFQNRGEKEITAIRLGQTTLPAGMQLNEFAPITVLQPQQTASGVLGVDFNDSTHAVDLELLSSAGSSRLQLKPPV GELVRSVQIGESCHREERAKLRGMNEHQCELRGLRQDLIDVVALRQKVFESINVAHTHSSSSGQLHCFAGQTLSSKSLVL LTLDWKTEDALTLLVNCEKMVIGSMVLNELRNALQLSFAM
view sequence (1160 aa)
>rb-PC
MQQNSASNPFAMSTYVERPQMGLDVEFGADPASGAAFFQSDGRKHDDLKQMLDSNKDGLKLEAMKRIIGMIARGRDASDL
FPAVVKNVVSKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLSSIRVSMIVPIVMLAIRDSA
ADLSPYVRKTAAHAIPKLYSLDADQKDELVMVIEKLLSDRTTLVVGSAVMAFDEVCPERVDLIHKNYRKLCNFLLDVDEW
GQVIIINMLTRYARTQFVDPNADDEDLVNDGLGETPVSERFYDESSHSSSHSDDGSSDDEKNKSSTNNKNNGGGNGSRTP
SSPSNSYHIDVDHRLLLRQTKPLLQSRNASVVMAVAQLYHHVAPKNEVQLIAKALIRLLRSHKEVQSVVLNCIASMSTKR
KAIFEPHLKSFFVRTSDPTHIKLLKLDILTNLASAGSISLILREFQTYISSSDRSFVAATIQAIGRCASSIKEVTETCLS
GLVHLLSNHDEHVVAESVVVIKRLLQTKAAEHFEIITQMAKLIDYINVPAARAAIIWLIGEYNEKVPLIAPDVLRKMAKS
FVDEQDVVKLQVLNLGVKLYLTNPEQTSLLCQYVFTLARYDPNYDVRDRARFLRQIIFPASGTSSVLSQHARQVFLASKP
APVPESKYRDGNNFQLGSLSHYLNMPAAGYKELPAFPVIPPDSSVRNIAGFMQDKLPGEDSPSGHSKDKSGREGGKEKGA
GGEKGFLSESDDKSSAYSESGSSSGSGTSDSESDSDGSGSSDEEEEEVQKQQPTKVSSVKERLIDAGSNELAATSSPVKA
TINNNNNARGSSGTSDSEDSSAYSGSSSDDSASGSDNEVKKNETKTDTGTKPEKLKEKHEKQPEQTAVKSNLDLLLDLDD
IPPIGPVMTPSLGGFLTPGTPMMAGQAAPLQPQHARNRVELVGPSHIEFKHKELLNKVSGHGLHLAYRFTRSPHLYSSSM
CSIELQFQNRGEKEITAIRLGQTTLPAGMQLNEFAPITVLQPQQTASGVLGVDFNDSTHAVDLELLSSAGSSRLQLKPPV
GELVRSVQIGESCHREERAKLRGMNEHQCELRGLRQDLIDVVALRQKVFESINVAHTHSSSSGQLHCFAGQTLSSKSLVL
LTLDWKTEDALTLLVNCEKMVIGSMVLNELRNALQLSFAM
Estimated Isoelectric Point:
6.09439849853516
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr50
Lys70
Gln53
Leu123
Gly67
Met26
Ser133
Tyr25
His32
Glu71
Arg58
Cys11
Phe34
Pro52
Val85
Asn51
Ala88
Ile55
Trp3
Asp73