Sequence:
download
FLYBASE:CG1081sequence.fasta
>Rheb-PB MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGY VLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFH QLLILIENENGNPQEKSGCLVS
view sequence (182 aa)
>Rheb-PB
MPTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTAGQDEYSIFPVQYSMDYHGY
VLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERTVSTEEGKKLAESWRAAFLETSAKQNESVGDIFH
QLLILIENENGNPQEKSGCLVS
Estimated Isoelectric Point:
5.42693328857422
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys15
Gln10
Leu13
Gly11
Met5
Ser16
Tyr10
His4
Glu16
Arg5
Cys2
Phe7
Pro5
Val18
Asn6
Ala6
Ile14
Trp1
Asp9