Sequence:
download
FLYBASE:CG10476sequence.fasta
>AANATL5-PA MILSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGLLVGI AVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKLG RLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYADYKDEQGRPIYNPPAPHTHIRVLASKL
view sequence (222 aa)
>AANATL5-PA
MILSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGLLVGI
AVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKLG
RLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYADYKDEQGRPIYNPPAPHTHIRVLASKL
Estimated Isoelectric Point:
6.50669097900391
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys11
Gln7
Leu21
Gly16
Met10
Ser15
Tyr9
His9
Glu18
Arg16
Cys3
Phe7
Pro10
Val15
Asn7
Ala15
Ile16
Asp11