Sequence:
download
ENSEMBL:ENSP00000418910sequence.fasta
>SELENOT MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSCGYRRVFEEYMRVISQRYPDIRIEGENYLPQP IYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWS KLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS
view sequence (195 aa)
>SELENOT
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSCGYRRVFEEYMRVISQRYPDIRIEGENYLPQP
IYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQWGQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWS
KLESGHLPSMQQLVQILDNEMKLNVHMDSIPHHRS
Estimated Isoelectric Point:
8.69280242919922
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr3
Lys8
Gln11
Leu22
Gly11
Met12
Ser16
Tyr7
His5
Glu10
Arg10
Cys4
Phe10
Pro10
Val15
Asn8
Ala11
Ile14
Trp3
Asp5