Sequence:
download
ENSEMBL:ENSP00000418561sequence.fasta
>CYP21A2 MLLLGLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVVVLNSKRTIEEA MVKKWADFAGRPEPLTYKXXXXXXXXLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAI EEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQ LRQHKESLVAGQWRDMMDYMLQGVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANTLSWAVVFLLHHPEIQQRLQEE LDHELGPGASSXXXXXXXXXXXXXXXXXXXXXXRLRPVVPLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWER PHEFWPDRFLEPGKNSRALAFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL QPRGMGAHSPGQXQ
view sequence (494 aa)
>CYP21A2
MLLLGLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIYRLHLGLQDVVVLNSKRTIEEA
MVKKWADFAGRPEPLTYKXXXXXXXXLSLGDYSLLWKAHKKLTRSALLLGIRDSMEPVVEQLTQEFCERMRAQPGTPVAI
EEEFSLLTCSIICYLTFGDKIKDDNLMPAYYKCIQEVLKTWSHWSIQIVDVIPFLRFFPNPGLRRLKQAIEKRDHIVEMQ
LRQHKESLVAGQWRDMMDYMLQGVAQPSMEEGSGQLLEGHVHMAAVDLLIGGTETTANTLSWAVVFLLHHPEIQQRLQEE
LDHELGPGASSXXXXXXXXXXXXXXXXXXXXXXRLRPVVPLALPHRTTRPSSISGYDIPEGTVIIPNLQGAHLDETVWER
PHEFWPDRFLEPGKNSRALAFGCGARVCLGEPLARLELFVVLTRLLQAFTLLPSGDALPSLQPLPHCSVILKMQPFQVRL
QPRGMGAHSPGQXQ
Estimated Isoelectric Point:
6.99695587158203
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys18
Gln26
Leu78
Gly32
Met13
Ser24
Tyr9
His17
Glu29
Arg28
Cys7
Phe16
Pro36
Val26
Xaa**31
Asn7
Ala28
Ile21
Trp11
Asp18