Sequence:
download
ENSEMBL:ENSP00000418444sequence.fasta
>PLSCR2 MPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRIT DNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDF E
view sequence (161 aa)
>PLSCR2
MPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRIT
DNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDF
E
Estimated Isoelectric Point:
5.39830780029297
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys5
Gln8
Leu13
Gly8
Met3
Ser8
Tyr4
His2
Glu12
Arg9
Cys15
Phe8
Pro15
Val9
Asn8
Ala5
Ile15
Trp1
Asp5