Sequence:
download
ENSEMBL:ENSP00000411685sequence.fasta
>LOC84661 MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERVLQQ RENTAVKYNLKNSANFSQHCFWTFLRVGSGHLQWLNKYHR
view sequence (120 aa)
>LOC84661
MEPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSLPTRAYLDQTVVPILLQGLAVLAKERVLQQ
RENTAVKYNLKNSANFSQHCFWTFLRVGSGHLQWLNKYHR
Estimated Isoelectric Point:
6.90798187255859
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys8
Gln11
Leu14
Gly5
Met2
Ser7
Tyr4
His4
Glu11
Arg6
Cys1
Phe3
Pro4
Val10
Asn9
Ala7
Ile3
Trp2
Asp3