Sequence:
download
ENSEMBL:ENSP00000401801sequence.fasta
>STX16 GISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQR AVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGT VLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR
view sequence (219 aa)
>STX16
GISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQR
AVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGT
VLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR
Estimated Isoelectric Point:
7.24678802490234
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys15
Gln15
Leu23
Gly11
Met4
Ser14
Tyr5
His8
Glu16
Arg16
Cys3
Phe5
Pro7
Val17
Asn6
Ala13
Ile15
Trp1
Asp15