Sequence:
download
ENSEMBL:ENSP00000399412sequence.fasta
>ENSEMBL:ENSP00000399412 MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAAS SSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSIS STIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYN TPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNK RRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESE RHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR
view sequence (437 aa)
>ENSEMBL:ENSP00000399412
MAAAITDMADLEELSRLSPLPPGSPGSAARGRAEPPEEEEEDESSSSGGGEEESSAESLVGSSGGSSSDETRSLSPGAAS
SSSGDGDGKEGLEEPKGPRGSQGGGGGGSSSSSVVSSGGDEGYGTGGGGSSATSGGRRGSLEMSSDGEPLSRMDSEDSIS
STIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYN
TPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNK
RRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESE
RHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR
Estimated Isoelectric Point:
6.92421722412109
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr18
Lys26
Gln14
Leu30
Gly50
Met11
Ser73
Tyr4
His14
Glu28
Arg26
Cys9
Phe9
Pro24
Val19
Asn12
Ala26
Ile14
Trp5
Asp25