Sequence:
download
ENSEMBL:ENSP00000375905sequence.fasta
>LGALS14 MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYY LPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
view sequence (139 aa)
>LGALS14
MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYY
LPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
Estimated Isoelectric Point:
6.39913177490234
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys6
Gln4
Leu11
Gly7
Met5
Ser9
Tyr8
His4
Glu7
Arg7
Cys4
Phe11
Pro11
Val13
Asn4
Ala4
Ile10
Trp1
Asp7