Sequence:
download
ENSEMBL:ENSP00000373810sequence.fasta
>NOP16 MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDI EERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYP AEWQDFLDSLQKRKMEVE
view sequence (178 aa)
>NOP16
MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDI
EERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYP
AEWQDFLDSLQKRKMEVE
Estimated Isoelectric Point:
9.93758392333984
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr3
Lys21
Gln6
Leu12
Gly5
Met6
Ser7
Tyr9
His4
Glu15
Arg21
Cys1
Phe3
Pro9
Val12
Asn10
Ala15
Ile6
Trp2
Asp11