Sequence:
download
ENSEMBL:ENSP00000369251sequence.fasta
>MAB21L1 MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYL NQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKL RIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGKQSSAESDAWVLQFAEAENR LQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYF LPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL
view sequence (359 aa)
>MAB21L1
MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMDNRYEGLEVISPTEFEVVLYL
NQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKL
RIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGKQSSAESDAWVLQFAEAENR
LQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYF
LPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL
Estimated Isoelectric Point:
8.93889617919922
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys26
Gln15
Leu41
Gly16
Met7
Ser26
Tyr11
His9
Glu26
Arg25
Cys13
Phe11
Pro17
Val26
Asn15
Ala27
Ile15
Trp7
Asp15