Sequence:
download
ENSEMBL:ENSP00000366249sequence.fasta
>UBD MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKV VKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLAC YCIGG
view sequence (165 aa)
>UBD
MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKV
VKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLAC
YCIGG
Estimated Isoelectric Point:
9.08234405517578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys17
Gln5
Leu18
Gly10
Met5
Ser13
Tyr4
His4
Glu11
Arg9
Cys5
Phe3
Pro7
Val14
Asn4
Ala8
Ile10
Trp1
Asp9