Sequence:
download
ENSEMBL:ENSP00000366144sequence.fasta
>SOX21 MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEHPDYKYRPR RKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAAAAAAAARVFFPQSAAAAAAA AAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAAAAGGHTHSHPSPGNPGYMIPCNC SAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL
view sequence (276 aa)
>SOX21
MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEHPDYKYRPR
RKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAAAAAAAARVFFPQSAAAAAAA
AAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAAAAGGHTHSHPSPGNPGYMIPCNC
SAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL
Estimated Isoelectric Point:
9.73752593994141
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys19
Gln5
Leu23
Gly24
Met10
Ser21
Tyr10
His10
Glu11
Arg12
Cys2
Phe7
Pro28
Val7
Asn6
Ala62
Ile5
Trp3
Asp7