Sequence:
download
ENSEMBL:ENSP00000362936sequence.fasta
>TRNAU1AP MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFK LNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGA VGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDA LEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM
view sequence (287 aa)
>TRNAU1AP
MAASLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAGYCFVEFADLATAEKCLHKINGKPLPGATPAKRFK
LNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVYPSCRGGKVVLDQTGVSKGYGFVKFTDELEQKRALTECQGA
VGLGSKPVRLSVAIPKASRVKPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDA
LEDPMPQLDVTEANKEFMEQSEELYDALMDCHWQPLDTVSSEIPAMM
Estimated Isoelectric Point:
4.61324310302734
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys16
Gln17
Leu20
Gly21
Met13
Ser20
Tyr25
His2
Glu20
Arg8
Cys5
Phe11
Pro17
Val19
Asn9
Ala20
Ile7
Trp3
Asp18