Sequence:
download
ENSEMBL:ENSP00000360500sequence.fasta
>DMRTB1 MADKMVRTPKCSRCRNHGFLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALCAQGPKQASGA AAAAPAPVPVPAASLRPLSPGTPSGDADPGPEGRAAACFFEQPPRGRNPGPRALQPVLGGRSHVEPSERAAVAMPSLAGP PFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHV SRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENT DDQDAEVLSGEPSQPSSQEQSD
view sequence (342 aa)
>DMRTB1
MADKMVRTPKCSRCRNHGFLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALCAQGPKQASGA
AAAAPAPVPVPAASLRPLSPGTPSGDADPGPEGRAAACFFEQPPRGRNPGPRALQPVLGGRSHVEPSERAAVAMPSLAGP
PFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHV
SRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENT
DDQDAEVLSGEPSQPSSQEQSD
Estimated Isoelectric Point:
6.59748077392578
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys11
Gln20
Leu30
Gly32
Met6
Ser25
Tyr9
His6
Glu17
Arg19
Cys9
Phe13
Pro64
Val16
Asn5
Ala34
Ile3
Trp1
Asp14