Sequence:
download
ENSEMBL:ENSP00000360104sequence.fasta
>LEPROT MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVS AFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW
view sequence (131 aa)
>LEPROT
MAGVKALVALSFSGAIGLTFLMLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSDATSSACRELAYFFTTGIVVS
AFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIFGRGDDFSWEQW
Estimated Isoelectric Point:
6.01418304443359
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys3
Gln2
Leu14
Gly13
Met2
Ser8
Tyr4
His2
Glu3
Arg4
Cys3
Phe14
Pro4
Val12
Asn1
Ala16
Ile11
Trp4
Asp5