Sequence:
download
ENSEMBL:ENSP00000357564sequence.fasta
>RAB13 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRG AMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDE AFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG
view sequence (203 aa)
>RAB13
MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRG
AMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDE
AFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG
Estimated Isoelectric Point:
9.26894378662109
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr13
Lys23
Gln5
Leu16
Gly16
Met5
Ser14
Tyr5
His2
Glu12
Arg11
Cys4
Phe9
Pro2
Val7
Asn12
Ala14
Ile17
Trp2
Asp14