Sequence:
download
ENSEMBL:ENSP00000350409sequence.fasta
>UNC50 MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARD DPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVH LNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL ALGWNFTHTLCSFYKYRVK
view sequence (259 aa)
>UNC50
MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYRKQTKDQWARD
DPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVH
LNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL
ALGWNFTHTLCSFYKYRVK
Estimated Isoelectric Point:
9.49655914306641
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys10
Gln8
Leu41
Gly15
Met5
Ser12
Tyr18
His6
Glu3
Arg14
Cys3
Phe23
Pro7
Val22
Asn10
Ala15
Ile14
Trp8
Asp11