Sequence:
download
ENSEMBL:ENSP00000350353sequence.fasta
>ETFBKMT MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLRLLTPRCKFWW ERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCEL NRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTYRTRVLIGDPGRPQFSGHSIQHHLHKVVEYS LLESTRQENSGLTTSTVWGFQP
view sequence (262 aa)
>ETFBKMT
MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLRLLTPRCKFWW
ERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASRILANDIDPIAGMAITLNCEL
NRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTYRTRVLIGDPGRPQFSGHSIQHHLHKVVEYS
LLESTRQENSGLTTSTVWGFQP
Estimated Isoelectric Point:
6.05231475830078
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys9
Gln11
Leu38
Gly21
Met4
Ser20
Tyr6
His8
Glu12
Arg14
Cys7
Phe9
Pro15
Val10
Asn10
Ala17
Ile13
Trp11
Asp15