Sequence:
download
ENSEMBL:ENSP00000349415sequence.fasta
>RAB18 MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRG AQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQC AFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL
view sequence (206 aa)
>RAB18
MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRG
AQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQC
AFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL
Estimated Isoelectric Point:
5.11322784423828
Estimated Molecular Weight:
kD
Amino Acid Composition:
Amino Acid Frequency
Thr15
Lys15
Gln6
Leu20
Gly19
Met3
Ser10
Tyr5
His2
Glu17
Arg11
Cys5
Phe8
Pro3
Val16
Asn10
Ala11
Ile12
Trp3
Asp15